LOCUS       NM_026509               4479 bp    mRNA    linear   ROD 02-APR-2024
DEFINITION  Mus musculus caveolae associated 4 (Cavin4), mRNA.
ACCESSION   NM_026509
VERSION     NM_026509.4
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Mus musculus (house mouse)
  ORGANISM  Mus musculus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Mus; Mus.
REFERENCE   1  (bases 1 to 4479)
  AUTHORS   Lo,H.P., Lim,Y.W., Xiong,Z., Martel,N., Ferguson,C., Ariotti,N.,
            Giacomotto,J., Rae,J., Floetenmeyer,M., Moradi,S.V., Gao,Y.,
            Tillu,V.A., Xia,D., Wang,H., Rahnama,S., Nixon,S.J., Bastiani,M.,
            Day,R.D., Smith,K.A., Palpant,N.J., Johnston,W.A., Alexandrov,K.,
            Collins,B.M., Hall,T.E. and Parton,R.G.
  TITLE     Cavin4 interacts with Bin1 to promote T-tubule formation and
            stability in developing skeletal muscle
  JOURNAL   J Cell Biol 220 (12) (2021)
   PUBMED   34633413
  REMARK    GeneRIF: Cavin4 interacts with Bin1 to promote T-tubule formation
            and stability in developing skeletal muscle.
REFERENCE   2  (bases 1 to 4479)
  AUTHORS   Nishi,M., Ogata,T., Cannistraci,C.V., Ciucci,S., Nakanishi,N.,
            Higuchi,Y., Sakamoto,A., Tsuji,Y., Mizushima,K. and Matoba,S.
  TITLE     Systems Network Genomic Analysis Reveals Cardioprotective Effect of
            MURC/Cavin-4 Deletion Against Ischemia/Reperfusion Injury
  JOURNAL   J Am Heart Assoc 8 (15), e012047 (2019)
   PUBMED   31364493
  REMARK    GeneRIF: Systems Network Genomic Analysis Reveals Cardioprotective
            Effect of MURC/Cavin-4 Deletion Against Ischemia/Reperfusion
            Injury.
REFERENCE   3  (bases 1 to 4479)
  AUTHORS   Miyagawa,K., Ogata,T., Ueyama,T., Kasahara,T., Nakanishi,N.,
            Naito,D., Taniguchi,T., Hamaoka,T., Maruyama,N., Nishi,M.,
            Kimura,T., Yamada,H., Aoki,H. and Matoba,S.
  TITLE     Loss of MURC/Cavin-4 induces JNK and MMP-9 activity enhancement in
            vascular smooth muscle cells and exacerbates abdominal aortic
            aneurysm
  JOURNAL   Biochem Biophys Res Commun 487 (3), 587-593 (2017)
   PUBMED   28433630
  REMARK    GeneRIF: The MURC/Cavin-4 in vascular smooth muscle cells modulates
            abdominal aortic aneurysm (AAA) progression at the early stage via
            the activation of JNK and MMP-9. MURC/Cavin-4 is a potential
            therapeutic target against AAA progression.
REFERENCE   4  (bases 1 to 4479)
  AUTHORS   Bang,M.L.
  TITLE     Animal Models of Congenital Cardiomyopathies Associated With
            Mutations in Z-Line Proteins
  JOURNAL   J Cell Physiol 232 (1), 38-52 (2017)
   PUBMED   27171814
  REMARK    Review article
REFERENCE   5  (bases 1 to 4479)
  AUTHORS   Nakanishi,N., Ogata,T., Naito,D., Miyagawa,K., Taniguchi,T.,
            Hamaoka,T., Maruyama,N., Kasahara,T., Nishi,M., Matoba,S. and
            Ueyama,T.
  TITLE     MURC deficiency in smooth muscle attenuates pulmonary hypertension
  JOURNAL   Nat Commun 7, 12417 (2016)
   PUBMED   27546070
  REMARK    GeneRIF: MURC binds to Cav1 and inhibits the association of Cav1
            with the active form of Galpha13, resulting in the facilitated
            association of the active form of Galpha13 with p115RhoGEF. These
            results reveal that MURC has a function in the development of
            pulmonary hypertension through modulating Rho/ROCK signaling.
            Publication Status: Online-Only
REFERENCE   6  (bases 1 to 4479)
  AUTHORS   Ogata,T., Naito,D., Nakanishi,N., Hayashi,Y.K., Taniguchi,T.,
            Miyagawa,K., Hamaoka,T., Maruyama,N., Matoba,S., Ikeda,K.,
            Yamada,H., Oh,H. and Ueyama,T.
  TITLE     MURC/Cavin-4 facilitates recruitment of ERK to caveolae and
            concentric cardiac hypertrophy induced by alpha1-adrenergic
            receptors
  JOURNAL   Proc Natl Acad Sci U S A 111 (10), 3811-3816 (2014)
   PUBMED   24567387
  REMARK    GeneRIF: MURC/Cavin-4 facilitates recruitment of ERK to caveolae
            and concentric cardiac hypertrophy induced by alpha1-adrenergic
            receptors.
REFERENCE   7  (bases 1 to 4479)
  AUTHORS   Ludwig,A., Howard,G., Mendoza-Topaz,C., Deerinck,T., Mackey,M.,
            Sandin,S., Ellisman,M.H. and Nichols,B.J.
  TITLE     Molecular composition and ultrastructure of the caveolar coat
            complex
  JOURNAL   PLoS Biol 11 (8), e1001640 (2013)
   PUBMED   24013648
REFERENCE   8  (bases 1 to 4479)
  AUTHORS   Bastiani,M., Liu,L., Hill,M.M., Jedrychowski,M.P., Nixon,S.J.,
            Lo,H.P., Abankwa,D., Luetterforst,R., Fernandez-Rojo,M.,
            Breen,M.R., Gygi,S.P., Vinten,J., Walser,P.J., North,K.N.,
            Hancock,J.F., Pilch,P.F. and Parton,R.G.
  TITLE     MURC/Cavin-4 and cavin family members form tissue-specific caveolar
            complexes
  JOURNAL   J Cell Biol 185 (7), 1259-1273 (2009)
   PUBMED   19546242
  REMARK    GeneRIF: Data show that MURC/Cavin-4 forms a multiprotein complex
            that associates with caveolae, and identify Cavin-4 as a novel
            muscle disease candidate caveolar protein.
REFERENCE   9  (bases 1 to 4479)
  AUTHORS   Tagawa,M., Ueyama,T., Ogata,T., Takehara,N., Nakajima,N.,
            Isodono,K., Asada,S., Takahashi,T., Matsubara,H. and Oh,H.
  TITLE     MURC, a muscle-restricted coiled-coil protein, is involved in the
            regulation of skeletal myogenesis
  JOURNAL   Am J Physiol Cell Physiol 295 (2), C490-C498 (2008)
   PUBMED   18508909
  REMARK    GeneRIF: findings suggest that MURC is involved in the skeletal
            myogenesis that results from modulation of myogenin expression and
            ERK activation; MURC may play pivotal roles in the molecular
            mechanisms of skeletal myogenic differentiation
REFERENCE   10 (bases 1 to 4479)
  AUTHORS   Ogata,T., Ueyama,T., Isodono,K., Tagawa,M., Takehara,N.,
            Kawashima,T., Harada,K., Takahashi,T., Shioi,T., Matsubara,H. and
            Oh,H.
  TITLE     MURC, a muscle-restricted coiled-coil protein that modulates the
            Rho/ROCK pathway, induces cardiac dysfunction and conduction
            disturbance
  JOURNAL   Mol Cell Biol 28 (10), 3424-3436 (2008)
   PUBMED   18332105
  REMARK    GeneRIF: MURC modulates RhoA signaling, and MURC plays an important
            role in the development of cardiac dysfunction and conduction
            disturbance with increased vulnerability to atrial arrhythmias.
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            AL807771.6.
            
            On Apr 2, 2024 this sequence version replaced NM_026509.3.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BC089601.1, AK009691.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMN00849375, SAMN00849383
                                           [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on single protein-coding transcript
            ##RefSeq-Attributes-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-476               AL807771.6         34882-35357
            477-4479            AL807771.6         43293-47295
FEATURES             Location/Qualifiers
     source          1..4479
                     /organism="Mus musculus"
                     /mol_type="mRNA"
                     /strain="C57BL/6"
                     /db_xref="taxon:10090"
                     /chromosome="4"
                     /map="4 26.23 cM"
     gene            1..4479
                     /gene="Cavin4"
                     /gene_synonym="2310039E09Rik; Murc"
                     /note="caveolae associated 4"
                     /db_xref="GeneID:68016"
                     /db_xref="MGI:MGI:1915266"
     exon            1..476
                     /gene="Cavin4"
                     /gene_synonym="2310039E09Rik; Murc"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    54..56
                     /gene="Cavin4"
                     /gene_synonym="2310039E09Rik; Murc"
                     /note="upstream in-frame stop codon"
     CDS             69..1157
                     /gene="Cavin4"
                     /gene_synonym="2310039E09Rik; Murc"
                     /note="muscle-restricted coiled-coil protein; cavin 4;
                     muscle-related coiled-coil protein"
                     /codon_start=1
                     /product="caveolae-associated protein 4"
                     /protein_id="NP_080785.2"
                     /db_xref="CCDS:CCDS18169.2"
                     /db_xref="GeneID:68016"
                     /db_xref="MGI:MGI:1915266"
                     /translation="

MEHNGSASNAGKIHQNRLSSVTEDEDQDAALTIVTVLDRVASVVDSVQASQKRIEERHREMGNAIKSVQIDLLKLSQSHSNTGYVVNKLFEKTRKVSAHIKDVKARVEKQQVRVTKVETKQEEIMKKNKFRVVIFQEDIPCPASLSVVKDRSLPENQEEAEEVFDPPIELSSDEEYYVEESRSARLRKSGKEHIDHIKKAFSRENMQKTRQTLDKKVSGIRTRIVTPERRERLRQSGERLRQSGERLRQSGERFKKSISSAAPSKEAFKIRSLRKAKDPKAEGQEVDRGMGVDIISGSLALGPIHEFHSDEFSETEKEVTKGGYSPQEGGDPPTPEPLKVTFKPQVRVEDDESLLLELKQSS"

     misc_feature    69..140
                     /gene="Cavin4"
                     /gene_synonym="2310039E09Rik; Murc"
                     /note="propagated from UniProtKB/Swiss-Prot (A2AMM0.1);
                     Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
     misc_feature    147..857
                     /gene="Cavin4"
                     /gene_synonym="2310039E09Rik; Murc"
                     /note="PTRF/SDPR family; Region: PTRF_SDPR; pfam15237"
                     /db_xref="CDD:464578"
     misc_feature    522..524
                     /gene="Cavin4"
                     /gene_synonym="2310039E09Rik; Murc"
                     /note="Phosphoserine.
                     /evidence=ECO:0000250|UniProtKB:B1PRL5; propagated from
                     UniProtKB/Swiss-Prot (A2AMM0.1); phosphorylation site"
     misc_feature    579..581
                     /gene="Cavin4"
                     /gene_synonym="2310039E09Rik; Murc"
                     /note="Phosphoserine.
                     /evidence=ECO:0000250|UniProtKB:B1PRL5; propagated from
                     UniProtKB/Swiss-Prot (A2AMM0.1); phosphorylation site"
     misc_feature    582..584
                     /gene="Cavin4"
                     /gene_synonym="2310039E09Rik; Murc"
                     /note="Phosphoserine.
                     /evidence=ECO:0000250|UniProtKB:B1PRL5; propagated from
                     UniProtKB/Swiss-Prot (A2AMM0.1); phosphorylation site"
     misc_feature    756..935
                     /gene="Cavin4"
                     /gene_synonym="2310039E09Rik; Murc"
                     /note="propagated from UniProtKB/Swiss-Prot (A2AMM0.1);
                     Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
     misc_feature    981..1106
                     /gene="Cavin4"
                     /gene_synonym="2310039E09Rik; Murc"
                     /note="propagated from UniProtKB/Swiss-Prot (A2AMM0.1);
                     Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
     misc_feature    1038..1040
                     /gene="Cavin4"
                     /gene_synonym="2310039E09Rik; Murc"
                     /note="Phosphotyrosine.
                     /evidence=ECO:0007744|PubMed:21183079; propagated from
                     UniProtKB/Swiss-Prot (A2AMM0.1); phosphorylation site"
     misc_feature    1068..1070
                     /gene="Cavin4"
                     /gene_synonym="2310039E09Rik; Murc"
                     /note="Phosphothreonine.
                     /evidence=ECO:0007744|PubMed:21183079; propagated from
                     UniProtKB/Swiss-Prot (A2AMM0.1); phosphorylation site"
     misc_feature    1125..1127
                     /gene="Cavin4"
                     /gene_synonym="2310039E09Rik; Murc"
                     /note="Phosphoserine.
                     /evidence=ECO:0007744|PubMed:21183079; propagated from
                     UniProtKB/Swiss-Prot (A2AMM0.1); phosphorylation site"
     exon            477..4479
                     /gene="Cavin4"
                     /gene_synonym="2310039E09Rik; Murc"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      

gccgacttttggctccaggcgtaggaaccggattgccataggacaccttctgctgagaaaaaagtaaaatggaacacaacggatcagcttcaaatgctggtaaaatccaccagaatcggttgtcaagtgtgacggaagatgaagaccaagacgcagccctcaccattgtgaccgtgctggacagagtggccagtgtcgtggacagtgtgcaggcaagccagaagagaattgaggagagacacagagaaatgggtaacgcgataaagtctgtccaaatagacctgctgaagctctcacagtcacacagcaatacgggctacgttgtcaacaagctgtttgagaagacccggaaagtcagcgctcacattaaggatgtcaaggcccgggtagagaagcaacaggttcgtgtaaccaaagtcgaaaccaagcaagaagaaataatgaagaaaaacaaattccgagtggtaatcttccaggaggacattccctgccccgcatccctgtctgttgttaaagacagaagcctgcccgagaaccaggaggaggccgaagaagtcttcgatcccccaatagagctctcctcggatgaggagtattatgttgaagaaagcagatctgccaggcttaggaagtcaggcaaagagcacattgaccacatcaagaaagccttttccagagaaaacatgcagaagacacggcagactcttgacaagaaagtgagtgggattagaactaggatagtcactcctgagaggagagagaggctgaggcagtcgggagagaggctgaggcagtcaggagagaggctgaggcagtcgggggaaagatttaagaaatcgatttccagtgccgctccctcaaaggaagcttttaagattcggagccttaggaaagcgaaggatcccaaggccgagggccaggaggtagacagagggatgggcgtggacatcatctcaggtagcctggctctggggcccatccatgagttccactctgatgagttcagtgaaacagaaaaggaggtgaccaaaggagggtacagtccccaagaaggaggggaccccccaacgcctgagcctttgaaggtgacttttaaaccccaggtgagggtagaggatgacgagtcactcctgttggagctaaagcagtcctcatagaggatttaagtacgagcatccatcacttggaatcatgtggttgtagtttgaatggtgtggtattcatattcatttatattcatccgcagtggaaaggcagatggtagaaaagcttcatttcttacctctaaaatcctaaagatgctggaaatattatatacaatttttgtacaatttccttgggaattctattcccctgagaatatatgactctgacagcaccccacccctgtctgcctacccccttacgtcatgccttttcgtggcagctcttggccaatgagaaaatagttgcacggctctggtcagttagatgatatgccattcataacacaggaacaacggatctgtgtccgttgttcatcagcaaactctagatctgggtcaggattgacacatccagtcaagaaggggagtagctgatgagtacatcgtgttatccagatgttcacatctggagattcattagtgagtcagtagccttatgaaggttacaaagttcttgtgtgagggaaaggaaatggaagtctgggacttgaacattttagctgcggcaacataactttattctagtgagatacttggctggttgccacatattctcaatgctaaaatgaaaaaaagggcttgctcttcctgtacttcttggagaacttgagatctgaggtggtgtcacagagtttgtgagaacaagacacacgacaagtggagaagcccacaaatcgcactggctcccctaacacagaatggaaacagttacatctgtgaggaagccctcggcacaggctccaaggccagagctgagcggaaactggggtggttcacaagtcttcacggaataaagagtgaaaaaagaatgcttgcatgggtgccttctcgttacagactgagaccataccttggccttttagccacgtcctaacatactccttggaaatctgcctctaattgtctttagatttggacatggtgtgggcgagtgcaggtgttgtttgcacagcacaaggtagaagtatggggctcagttgtcaagtggcttttctggggtctgccctgatgtgctggacatgggaatgacttccggcatgcctgttttccagagtgagccctttagggctaagaacagcacccctaagctgtcacagccaccttggagggcgtccaattcctgttacctcttagatttacatctgggtggtcaagaagtagaaattgctactgaaggaaaaccatactgattccgcacttccagcacactgtagtcttcaggtcattttcttgatatggaaaagatggtaggattttatatatatatattttactcacatttagtttaatttggaatattcatgtagtacttaaataaatgcaggcatgacggtgcatgtctgctaccccagcactgagaaggctgaaacaggtcacaaatggagtgagcctggattctctttatatgtacagatcagtatagtttccttttcgcatggcctgaatacatgttcttcttgctgcctcctcttcctcctcctcctccctcctcctccctcctcctccttctcctcttcctactcttcctcttcttcctcctcctttctcctcctccttcctcctcctcctcctcctctcttttggtttgtttgtttgtttttgttttttttgagacagggtttctttgtgtggccttggatgtcctggaactttctctgtagaccaggctggcctctaactcacagacacctgcctgcgtctgcctcctgagtgctggggttaaaggcatgcatcaccactacacagcatcttgttctctttatactgcaaactaaagcattgagtaaaactttgaaagaataattccaaacacattttcataacagctgagaaggaggttaggtgtccaagaataaatttgaatgtgagatgatgttattgcaaaacgtgaggccagtattgtggttgtaaatcttttaaccaatgacgaatggtaaccacaatatgcaaatgaaggatgagttaaccgatggtaaatcaaggctccgagggaatatagggaagtcagagctgtggtaagtcgagggtaggaagaatatcgagaagttacagtagttgttttccgtttgtttcatttggtctaaaatatttttctgcaaatatctagggcttttgtttactgactcattaatatccagccttaacagcttttaaagtgttgcaccagcagctatgttagagtctgactgggaaggagctatgtcctggccagctccttgtcttgatagctagcatttggcaccagaaccaccggatgttttgtgctgctgacggctcactgtaatcctgtgctctgtgttcactaacaggagtccccctccatgttgtaagatcatgtgtcagcatcttttcatgtctaggacatccctaaattctacattaaggatctcttgtaccagtccctccaggggtgactgacattcagccggtggtttggggagatgtaccttccactttagaccatggccaagttcatccgtaacttcgcaaagaaggcaccatcgatgatggccgctaccgtgacttactcgaagccttgattggccacattttggcactatgccaaggttgaggttgttcccccaacccctggtgaaacccctatgtgaattcagagcatgaactaaattattcagctgggcgtggtggcgcatgcctttaaccccagcacttgggaggcagaggaaggtgaatttctgagtttgaggccagcctggtctacagagtgagttccaggacagctagggctacacagagaaaccctgtcaaaaaaacaaaacaaaacaaaacaaaaaatcaaagtgctaaaactggtaacttcaaacacttccgatttgtgctcttatttgaacattcttgtatcttctaccttctttcatggcgtggagatgatgggctgcaaaattcacacactcacttaacgtaaatgacattctaggcagtgttcattattttaaaacacccggttacttactgatcagtagtgcagtgttacacaccaggctttaaacaatttactcaagtcaaacccttcgagggacttacccccttctgggagtgagatggagcagggcagctgctgcagttgctaggtgaggagctggggtggaggctctgccaggggagacagggaaaggcaagcctgtctcctgcatgtgatgatccaggtatcggagtcaacacgggcgttcggcttgtcgagagtggatttgtgtgtattccccaaaacaagttttcatgaataaaaagtagaagccaaagtaaaaaaatccaa

//