2024-04-20 14:08:20, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_023894 898 bp mRNA linear ROD 04-AUG-2023 DEFINITION Mus musculus reproductive homeobox 9 (Rhox9), mRNA. ACCESSION NM_023894 VERSION NM_023894.1 KEYWORDS RefSeq; RefSeq Select. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE 1 (bases 1 to 898) AUTHORS Thompson CL, Ng L, Menon V, Martinez S, Lee CK, Glattfelder K, Sunkin SM, Henry A, Lau C, Dang C, Garcia-Lopez R, Martinez-Ferre A, Pombero A, Rubenstein JLR, Wakeman WB, Hohmann J, Dee N, Sodt AJ, Young R, Smith K, Nguyen TN, Kidney J, Kuan L, Jeromin A, Kaykas A, Miller J, Page D, Orta G, Bernard A, Riley Z, Smith S, Wohnoutka P, Hawrylycz MJ, Puelles L and Jones AR. TITLE A high-resolution spatiotemporal atlas of gene expression of the developing mouse brain JOURNAL Neuron 83 (2), 309-323 (2014) PUBMED 24952961 REFERENCE 2 (bases 1 to 898) AUTHORS Wang Q, Liu X, Tang N, Archambeault DR, Li J, Song H, Tang C, He B, Matzuk MM and Wang Y. TITLE GASZ promotes germ cell derivation from embryonic stem cells JOURNAL Stem Cell Res 11 (2), 845-860 (2013) PUBMED 23816659 REFERENCE 3 (bases 1 to 898) AUTHORS Berletch JB, Deng X, Nguyen DK and Disteche CM. TITLE Female bias in Rhox6 and 9 regulation by the histone demethylase KDM6A JOURNAL PLoS Genet 9 (5), e1003489 (2013) PUBMED 23658530 REMARK GeneRIF: We report that two members of the Rhox cluster, Rhox6 and 9, are regulated by de-methylation of histone H3 at lysine 27 by KDM6A REFERENCE 4 (bases 1 to 898) AUTHORS Guo G, Huss M, Tong GQ, Wang C, Li Sun L, Clarke ND and Robson P. TITLE Resolution of cell fate decisions revealed by single-cell gene expression analysis from zygote to blastocyst JOURNAL Dev Cell 18 (4), 675-685 (2010) PUBMED 20412781 REFERENCE 5 (bases 1 to 898) AUTHORS Daggag H, Svingen T, Western PS, van den Bergen JA, McClive PJ, Harley VR, Koopman P and Sinclair AH. TITLE The rhox homeobox gene family shows sexually dimorphic and dynamic expression during mouse embryonic gonad development JOURNAL Biol Reprod 79 (3), 468-474 (2008) PUBMED 18562707 REFERENCE 6 (bases 1 to 898) AUTHORS Maclean JA 2nd, Chen MA, Wayne CM, Bruce SR, Rao M, Meistrich ML, Macleod C and Wilkinson MF. TITLE Rhox: a new homeobox gene cluster JOURNAL Cell 120 (3), 369-382 (2005) PUBMED 15707895 REFERENCE 7 (bases 1 to 898) AUTHORS Small CL, Shima JE, Uzumcu M, Skinner MK and Griswold MD. TITLE Profiling gene expression during the differentiation and development of the murine embryonic gonad JOURNAL Biol Reprod 72 (2), 492-501 (2005) PUBMED 15496517 REFERENCE 8 (bases 1 to 898) AUTHORS Takasaki N, Rankin T and Dean J. TITLE Normal gonadal development in mice lacking GPBOX, a homeobox protein expressed in germ cells at the onset of sexual dimorphism JOURNAL Mol Cell Biol 21 (23), 8197-8202 (2001) PUBMED 11689708 REFERENCE 9 (bases 1 to 898) AUTHORS Takasaki N, McIsaac R and Dean J. TITLE Gpbox (Psx2), a homeobox gene preferentially expressed in female germ cells at the onset of sexual dimorphism in mice JOURNAL Dev Biol 223 (1), 181-193 (2000) PUBMED 10864470 REFERENCE 10 (bases 1 to 898) AUTHORS Han YJ, Lee YH and Chun JY. TITLE Identification and characterization of Psx-2, a novel member of the Psx (placenta-specific homeobox) family JOURNAL Gene 241 (1), 149-155 (2000) PUBMED 10607909 COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from AF201698.1. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: AF201698.1, CK022884.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMN01164131, SAMN01164134 [ECO:0000348] ##Evidence-Data-END## ##RefSeq-Attributes-START## RefSeq Select criteria :: based on single protein-coding transcript ##RefSeq-Attributes-END## COMPLETENESS: complete on the 3' end. FEATURES Location/Qualifiers source 1..898 /organism="Mus musculus" /mol_type="mRNA" /db_xref="taxon:10090" /chromosome="X" /map="X 22.15 cM" gene 1..898 /gene="Rhox9" /gene_synonym="1600026O01Rik; Gpbox; Psx2" /note="reproductive homeobox 9" /db_xref="GeneID:104384" /db_xref="MGI:MGI:1890128" exon 1..173 /gene="Rhox9" /gene_synonym="1600026O01Rik; Gpbox; Psx2" /inference="alignment:Splign:2.1.0" CDS 92..775 /gene="Rhox9" /gene_synonym="1600026O01Rik; Gpbox; Psx2" /note="placenta specific homeobox 2; trophoblast-specific homeobox protein PSX2" /codon_start=1 /product="reproductive homeobox on X chromosome, 9" /protein_id="NP_076383.1" /db_xref="CCDS:CCDS30083.1" /db_xref="GeneID:104384" /db_xref="MGI:MGI:1890128" /translation="
METPQDSRQSIQKPPSPGAEEDKEEQHGGNAVVSGAGEEGIDKKELVMSGLAQGGLDQGEGAQGEVAGGEQAQEEPAPLSPAQEATGGEEEGENKEGEMEGRHAGDGASGPEDDNIQEEGGENIDQQPPQQEAAIPEGMRNPQAGNYLAHQRTRRTRFTHSQLRDLERLFQENRFPSLRVRRDLARWMGVDESDVQEWFKMRRALFRRHSRLMMFCELPPITENNSP"
misc_feature order(545..559,563..565,614..616,632..634,671..673, 677..682,689..694,698..706,710..715) /gene="Rhox9" /gene_synonym="1600026O01Rik; Gpbox; Psx2" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 551..712 /gene="Rhox9" /gene_synonym="1600026O01Rik; Gpbox; Psx2" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:425441" misc_feature order(551..553,560..562,680..682,689..694,701..703) /gene="Rhox9" /gene_synonym="1600026O01Rik; Gpbox; Psx2" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" exon 174..633 /gene="Rhox9" /gene_synonym="1600026O01Rik; Gpbox; Psx2" /inference="alignment:Splign:2.1.0" exon 634..679 /gene="Rhox9" /gene_synonym="1600026O01Rik; Gpbox; Psx2" /inference="alignment:Splign:2.1.0" exon 680..882 /gene="Rhox9" /gene_synonym="1600026O01Rik; Gpbox; Psx2" /inference="alignment:Splign:2.1.0" ORIGIN
agcagagagatatatattcaggctccggaactgtgaggacacagcgttggaagcctcttcgggagcagcgtcggatccagagattctcgctatggagactcctcaagacagccgccaaagcatccaaaagcctccgagtccgggagccgaggaggacaaggaagaacagcatggtgggaatgcagtggtctccggggctggagaggaaggaatagacaagaaagagcttgttatgagcgggcttgctcagggtgggcttgatcagggcgaaggcgctcagggcgaggttgctggaggtgagcaggctcaagaagagcctgctccattgagtccagctcaggaagccactggaggagaagaggagggagaaaacaaggaaggagaaatggaaggaagacatgctggtgatggtgcttctggccccgaggatgacaacatccaggaagaaggcggcgaaaacatagatcaacaaccgccgcaacaagaggcagccattcctgagggcatgagaaatccacaggctgggaactatctggctcaccagcggacccgccgcaccaggttcacccactctcagctgcgtgatctggagcgccttttccaagagaatcgcttccccagcttgcgagtaaggagggatcttgcacgatggatgggtgtggatgaatctgatgtgcaggagtggtttaagatgaggagagcccttttccgcagacacagcaggctgatgatgttctgcgaactgccaccgattacagagaacaactctccctgaagattttggagcagcacttgagtgcctcccctgtcgtggagccatgatggccaggacaacctttacttctctataattatttcaacaataaagatgagcattctgaaaaaaaaaaaaaaaaaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]