GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-08 10:45:43, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       NM_022175                794 bp    mRNA    linear   ROD 23-MAR-2023
DEFINITION  Rattus norvegicus Rhox homeobox family member 5 (Rhox5), mRNA.
ACCESSION   NM_022175 XM_039099478
VERSION     NM_022175.2
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
REFERENCE   1  (bases 1 to 794)
  AUTHORS   MacLean JA 2nd, Hayashi K, Turner TT and Wilkinson MF.
  TITLE     The Rhox5 homeobox gene regulates the region-specific expression of
            its paralogs in the rodent epididymis
  JOURNAL   Biol Reprod 86 (6), 189 (2012)
   PUBMED   22423045
  REMARK    GeneRIF: regulates the expression of other Rhox genes in the
            epididymis
            Publication Status: Online-Only
REFERENCE   2  (bases 1 to 794)
  AUTHORS   Bhardwaj A, Song HW, Beildeck M, Kerkhofs S, Castoro R, Shanker S,
            De Gendt K, Suzuki K, Claessens F, Issa JP, Orgebin-Crist MC and
            Wilkinson MF.
  TITLE     DNA demethylation-dependent AR recruitment and GATA factors drive
            Rhox5 homeobox gene transcription in the epididymis
  JOURNAL   Mol Endocrinol 26 (4), 538-549 (2012)
   PUBMED   22322598
  REMARK    GeneRIF: GATA factors collaborate to dictate the unique
            developmental and region-specific expression pattern of the RHOX5
            homeobox transcription factor in the caput epididymis.
REFERENCE   3  (bases 1 to 794)
  AUTHORS   MacLean JA 2nd, Rao MK, Doyle KM, Richards JS and Wilkinson MF.
  TITLE     Regulation of the Rhox5 homeobox gene in primary granulosa cells:
            preovulatory expression and dependence on SP1/SP3 and GABP
  JOURNAL   Biol Reprod 73 (6), 1126-1134 (2005)
   PUBMED   16093360
  REMARK    GeneRIF: expression in the ovary is governed by the distal promoter
            and is expressed at least as early as Day 5 postpartum. mRNA levels
            are regulated during the ovarian cycle, peaking before ovulation
REFERENCE   4  (bases 1 to 794)
  AUTHORS   Rao MK, Maiti S, Ananthaswamy HN and Wilkinson MF.
  TITLE     A highly active homeobox gene promoter regulated by Ets and Sp1
            family members in normal granulosa cells and diverse tumor cell
            types
  JOURNAL   J Biol Chem 277 (29), 26036-26045 (2002)
   PUBMED   11986330
  REMARK    GeneRIF: Pem promoter may be a useful model system to understand
            the molecular mechanism by which a tissue-specific promoter can be
            corrupted in tumor cells
REFERENCE   5  (bases 1 to 794)
  AUTHORS   Maiti S, Doskow J, Li S, Nhim RP, Lindsey JS and Wilkinson MF.
  TITLE     The Pem homeobox gene. Androgen-dependent and -independent
            promoters and tissue-specific alternative RNA splicing
  JOURNAL   J Biol Chem 271 (29), 17536-17546 (1996)
   PUBMED   8663309
REFERENCE   6  (bases 1 to 794)
  AUTHORS   Maiti S, Doskow J, Sutton K, Nhim RP, Lawlor DA, Levan K, Lindsey
            JS and Wilkinson MF.
  TITLE     The Pem homeobox gene: rapid evolution of the homeodomain, X
            chromosomal localization, and expression in reproductive tissue
  JOURNAL   Genomics 34 (3), 304-316 (1996)
   PUBMED   8786129
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            JACYVU010000455.1.
            
            On or before May 21, 2021 this sequence version replaced
            XM_039099478.1, NM_022175.1.
            
            ##Evidence-Data-START##
            Transcript exon combination :: FQ228987.1, SRR8487226.224217.1
                                           [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA5760434, SAMN06621351
                                           [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on expression
            ##RefSeq-Attributes-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-32                JACYVU010000455.1  1493352-1493383
            33-93               JACYVU010000455.1  1494323-1494383
            94-175              JACYVU010000455.1  1495027-1495108
            176-527             JACYVU010000455.1  1495276-1495627
            528-573             JACYVU010000455.1  1496235-1496280
            574-794             JACYVU010000455.1  1498726-1498946
FEATURES             Location/Qualifiers
     source          1..794
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /strain="BN"
                     /db_xref="taxon:10116"
                     /chromosome="X"
                     /map="Xq35"
     gene            1..794
                     /gene="Rhox5"
                     /gene_synonym="Pem"
                     /note="Rhox homeobox family member 5"
                     /db_xref="GeneID:24631"
                     /db_xref="RGD:3295"
     exon            1..32
                     /gene="Rhox5"
                     /gene_synonym="Pem"
                     /inference="alignment:Splign:2.1.0"
     exon            33..93
                     /gene="Rhox5"
                     /gene_synonym="Pem"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    58..60
                     /gene="Rhox5"
                     /gene_synonym="Pem"
                     /note="upstream in-frame stop codon"
     exon            94..175
                     /gene="Rhox5"
                     /gene_synonym="Pem"
                     /inference="alignment:Splign:2.1.0"
     CDS             97..723
                     /gene="Rhox5"
                     /gene_synonym="Pem"
                     /note="homeobox protein Pem; reproductive homeobox on
                     chromosome X 5; placenta and embryonic expression protein;
                     placentae and embryos oncofetal; Homeobox gene Pem;
                     reproductive homeobox 5"
                     /codon_start=1
                     /product="homeobox protein Rhox5"
                     /protein_id="NP_071511.2"
                     /db_xref="GeneID:24631"
                     /db_xref="RGD:3295"
                     /translation="
MEAQGSSHDISRLLCLGVKEDSEEQHDVKAEAFFQAGEGRDEKGAQGQPGEGAVGTEGEGEELNGGEGHFGPGVPGPVGEGDKDGGTRASGMEEEQHEPVAEGTESVKSEDKQMPLRRPGSTQRRLAELERILLSSGSSSGPTWEELDRWMDISVSRVQNWFKIRRAAYRRNRRRRTPIPEHFRATSGCPACLGARWGVRCPFATPRF"
     exon            176..527
                     /gene="Rhox5"
                     /gene_synonym="Pem"
                     /inference="alignment:Splign:2.1.0"
     exon            528..573
                     /gene="Rhox5"
                     /gene_synonym="Pem"
                     /inference="alignment:Splign:2.1.0"
     exon            574..794
                     /gene="Rhox5"
                     /gene_synonym="Pem"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
atattttggagagagaaaagccaagcagccatccttcaagatcacctcctgtattcctagctggacaagaggaaacacaaagagaaccatccagatatggaggctcaaggctctagccatgatatcagccgcttactctgcctgggagtcaaggaagactcggaagaacagcatgatgtgaaagcagaggctttctttcaggctggagaggggagagacgagaaaggtgcacagggtcagcctggagagggagcagtgggaacagaaggcgaaggagaagaattaaatggaggagaaggccactttggtcctggtgttccaggtcctgtgggtgagggggacaaggatggtggcaccagagctagtggcatggaggaggagcaacatgagcccgttgccgagggcactgagagtgtcaagtctgaggataagcagatgccactccgccgccctgggtccacccagcggcggctggcggaattggagcgcattttgctaagcagtggttcctccagtggcccaacatgggaggagcttgatagatggatggatatcagtgtgtccagagtgcagaattggtttaagattaggagggctgcatacagaagaaataggaggcggagaacaccaatccctgaacattttagagcaacatctgggtgccctgcttgtcttggagcaagatggggagtaagatgtccttttgcaacaccgagattttgatcacatatgccagccatgacaactcttgcctttcaacaattctgtcagcaataaagaaatgattctcagta
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]