LOCUS       NM_010759               1143 bp    mRNA    linear   ROD 05-NOV-2021
DEFINITION  Mus musculus MAGE family member B1 (Mageb1), mRNA.
ACCESSION   NM_010759
VERSION     NM_010759.1
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Mus musculus (house mouse)
  ORGANISM  Mus musculus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Mus; Mus.
REFERENCE   1  (bases 1 to 1143)
  AUTHORS   Gordeeva O, Gordeev A and Khaydukov S.
  TITLE     Expression dynamics of Mage family genes during self-renewal and
            differentiation of mouse pluripotent stem and teratocarcinoma cells
  JOURNAL   Oncotarget 10 (35), 3248-3266 (2019)
   PUBMED   31143371
  REMARK    Publication Status: Online-Only
REFERENCE   2  (bases 1 to 1143)
  AUTHORS   Bailey SD, Xie C, Do R, Montpetit A, Diaz R, Mohan V, Keavney B,
            Yusuf S, Gerstein HC, Engert JC and Anand S.
  CONSRTM   DREAM investigators
  TITLE     Variation at the NFATC2 locus increases the risk of
            thiazolidinedione-induced edema in the Diabetes REduction
            Assessment with ramipril and rosiglitazone Medication (DREAM) study
  JOURNAL   Diabetes Care 33 (10), 2250-2253 (2010)
   PUBMED   20628086
  REMARK    GeneRIF: Observational study of gene-disease association,
            gene-environment interaction, and pharmacogenomic / toxicogenomic.
            (HuGE Navigator)
REFERENCE   3  (bases 1 to 1143)
  AUTHORS   Talmud PJ, Drenos F, Shah S, Shah T, Palmen J, Verzilli C, Gaunt
            TR, Pallas J, Lovering R, Li K, Casas JP, Sofat R, Kumari M,
            Rodriguez S, Johnson T, Newhouse SJ, Dominiczak A, Samani NJ,
            Caulfield M, Sever P, Stanton A, Shields DC, Padmanabhan S,
            Melander O, Hastie C, Delles C, Ebrahim S, Marmot MG, Smith GD,
            Lawlor DA, Munroe PB, Day IN, Kivimaki M, Whittaker J, Humphries SE
            and Hingorani AD.
  CONSRTM   ASCOT investigators; NORDIL investigators; BRIGHT Consortium
  TITLE     Gene-centric association signals for lipids and apolipoproteins
            identified via the HumanCVD BeadChip
  JOURNAL   Am J Hum Genet 85 (5), 628-642 (2009)
   PUBMED   19913121
  REMARK    GeneRIF: Observational study of gene-disease association. (HuGE
            Navigator)
REFERENCE   4  (bases 1 to 1143)
  AUTHORS   Chomez P, De Backer O, Bertrand M, De Plaen E, Boon T and Lucas S.
  TITLE     An overview of the MAGE gene family with the identification of all
            human members of the family
  JOURNAL   Cancer Res 61 (14), 5544-5551 (2001)
   PUBMED   11454705
REFERENCE   5  (bases 1 to 1143)
  AUTHORS   Clotman F, De Backer O, De Plaen E, Boon T and Picard J.
  TITLE     Cell- and stage-specific expression of mage genes during mouse
            spermatogenesis
  JOURNAL   Mamm Genome 11 (8), 696-699 (2000)
   PUBMED   10920243
REFERENCE   6  (bases 1 to 1143)
  AUTHORS   De Plaen E, De Backer O, Arnaud D, Bonjean B, Chomez P, Martelange
            V, Avner P, Baldacci P, Babinet C, Hwang SY, Knowles B and Boon T.
  TITLE     A new family of mouse genes homologous to the human MAGE genes
  JOURNAL   Genomics 55 (2), 176-184 (1999)
   PUBMED   9933564
REFERENCE   7  (bases 1 to 1143)
  AUTHORS   Chomez P, Williams R, De Backer O, Boon T and Vennstrom B.
  TITLE     The SMAGE gene family is expressed in post-meiotic spermatids
            during mouse germ cell differentiation
  JOURNAL   Immunogenetics 43 (1-2), 97-100 (1996)
   PUBMED   8537132
REFERENCE   8  (bases 1 to 1143)
  AUTHORS   Dabovic B, Zanaria E, Bardoni B, Lisa A, Bordignon C, Russo V,
            Matessi C, Traversari C and Camerino G.
  TITLE     A family of rapidly evolving genes from the sex reversal critical
            region in Xp21
  JOURNAL   Mamm Genome 6 (9), 571-580 (1995)
   PUBMED   8535061
REFERENCE   9  (bases 1 to 1143)
  AUTHORS   De Backer O, Verheyden AM, Martin B, Godelaine D, De Plaen E,
            Brasseur R, Avner P and Boon T.
  TITLE     Structure, chromosomal location, and expression pattern of three
            mouse genes homologous to the human MAGE genes
  JOURNAL   Genomics 28 (1), 74-83 (1995)
   PUBMED   7590750
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from U19031.1.
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on single protein-coding transcript
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..1143
                     /organism="Mus musculus"
                     /mol_type="mRNA"
                     /strain="DBA/2"
                     /db_xref="taxon:10090"
                     /chromosome="X"
                     /map="X 40.59 cM"
     gene            1..1143
                     /gene="Mageb1"
                     /gene_synonym="dam1; Mage-b1; Mage-rs1; MAGE-Xp; Magel1;
                     Smage1"
                     /note="MAGE family member B1"
                     /db_xref="GeneID:17145"
                     /db_xref="MGI:MGI:105118"
     CDS             1..1143
                     /gene="Mageb1"
                     /gene_synonym="dam1; Mage-b1; Mage-rs1; MAGE-Xp; Magel1;
                     Smage1"
                     /note="melanoma antigen, family B, 1"
                     /codon_start=1
                     /product="MAGE family member B1"
                     /protein_id="NP_034889.1"
                     /db_xref="CCDS:CCDS30267.1"
                     /db_xref="GeneID:17145"
                     /db_xref="MGI:MGI:105118"
                     /translation="

MFSWKASKARSPLSPRYSLPGSTEVLTGCHSYPSRFLSASSFTSALSTVNMPRGQKSKTRSRAKRQQSRREVPVVQPTAEEAGSSPVDQSAGSSFPGGSAPQGVKTPGSFGAGVSCTGSGIGGRNAAVLPDTKSSDGTQAGTSIQHTLKDPIMRKASVLIEFLLDKFKMKEAVTRSEMLAVVNKKYKEQFPEILRRTSARLELVFGLELKEIDPSTHSYLLVGKLGLSTEGSLSSNWGLPRTGLLMSVLGVIFMKGNRATEQEVWQFLHGVGVYAGKKHLIFGEPEEFIRDVVRENYLEYRQVPGSDPPSYEFLWGPRAHAETTKMKVLEVLAKVNGTVPSAFPNLYQLALRDQAGGVPRRRVQGKGVHSKAPSQKSSNM"

     misc_feature    163..375
                     /gene="Mageb1"
                     /gene_synonym="dam1; Mage-b1; Mage-rs1; MAGE-Xp; Magel1;
                     Smage1"
                     /note="Melanoma associated antigen family N terminal;
                     Region: MAGE_N; pfam12440"
                     /db_xref="CDD:463582"
     misc_feature    517..978
                     /gene="Mageb1"
                     /gene_synonym="dam1; Mage-b1; Mage-rs1; MAGE-Xp; Magel1;
                     Smage1"
                     /note="MAGE homology domain; Region: MAGE; pfam01454"
                     /db_xref="CDD:426270"
     exon            1..1143
                     /gene="Mageb1"
                     /gene_synonym="dam1; Mage-b1; Mage-rs1; MAGE-Xp; Magel1;
                     Smage1"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      

atgttctcctggaaagcttcaaaagccaggtctccattaagtccaaggtattctctacctggtagtacagaggtacttacaggttgtcattcttatccttccagattcctgtctgccagctcttttacttcagccctgagcacagtcaacatgcctaggggtcaaaagagtaagacccgctcccgtgcaaaacgacagcagtcacgcagggaggttccagtagttcagcccactgcagaggaagcagggtcttctcctgttgaccagagtgctgggtccagcttccctggtggttctgctcctcagggtgtgaaaacccctggatcttttggtgcaggtgtatcctgcacaggctctggtataggtggtagaaatgctgctgtcctgcctgatacaaaaagttcagatggcacccaggcagggacttccattcagcacacactgaaagatcctatcatgaggaaggctagtgtgctgatagaattcctgctagataaatttaagatgaaagaagcagttacaaggagtgaaatgctggcagtagttaacaagaagtataaggagcaattccctgagatcctcaggagaacttctgcacgcctagaattagtctttggtcttgagttgaaggaaattgatcccagcactcattcctatttgctggtaggcaaactgggtctttccactgagggaagtttgagtagtaactgggggttgcctaggacaggtctcctaatgtctgtcctaggtgtgatcttcatgaagggtaaccgtgccactgagcaagaggtctggcaatttctgcatggagtgggggtatatgctgggaagaagcacttgatctttggcgagcctgaggagtttataagagatgtagtgcgggaaaattacctggagtaccgccaggtacctggcagtgatcccccaagctatgagttcctgtggggacccagagcccatgctgaaacaaccaagatgaaagtcctggaagttttagctaaagtcaatggcacagtccctagtgccttccctaatctctaccagttggctcttagagatcaggcaggaggggtgccaagaaggagagttcaaggcaagggtgttcattccaaggccccatcccaaaagtcctctaacatgtag

//