GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-04-25 19:26:31, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       NM_001286315            1639 bp    mRNA    linear   VRT 12-APR-2020
DEFINITION  Haplochromis burtoni distal-less homeobox 3b (dlx3b), mRNA.
ACCESSION   NM_001286315 XM_005932807
VERSION     NM_001286315.1
KEYWORDS    RefSeq.
SOURCE      Haplochromis burtoni (Burton's mouthbrooder)
  ORGANISM  Haplochromis burtoni
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Actinopterygii; Neopterygii; Teleostei; Neoteleostei;
            Acanthomorphata; Ovalentaria; Cichlomorphae; Cichliformes;
            Cichlidae; African cichlids; Pseudocrenilabrinae; Haplochromini;
            Haplochromis.
REFERENCE   1  (bases 1 to 1639)
  AUTHORS   Renz AJ, Gunter HM, Fischer JM, Qiu H, Meyer A and Kuraku S.
  TITLE     Ancestral and derived attributes of the dlx gene repertoire,
            cluster structure and expression patterns in an African cichlid
            fish
  JOURNAL   Evodevo 2 (1), 1 (2011)
   PUBMED   21205289
  REMARK    Publication Status: Online-Only
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from FN667598.1.
            
            On Nov 1, 2013 this sequence version replaced XM_005932807.1.
            
            ##Evidence-Data-START##
            Transcript exon combination :: FN667598.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMN00628004, SAMN00761590
                                           [ECO:0000348]
            ##Evidence-Data-END##
FEATURES             Location/Qualifiers
     source          1..1639
                     /organism="Haplochromis burtoni"
                     /mol_type="mRNA"
                     /db_xref="taxon:8153"
     gene            1..1639
                     /gene="dlx3b"
                     /gene_synonym="dlx3"
                     /note="distal-less homeobox 3b"
                     /db_xref="GeneID:102307675"
     exon            1..453
                     /gene="dlx3b"
                     /gene_synonym="dlx3"
                     /inference="alignment:Splign:2.0.8"
     CDS             111..956
                     /gene="dlx3b"
                     /gene_synonym="dlx3"
                     /note="distal-less homeobox protein 3b; distal-less
                     homeobox 3"
                     /codon_start=1
                     /product="homeobox protein Dlx3b"
                     /protein_id="NP_001273244.1"
                     /db_xref="GeneID:102307675"
                     /translation="
MSAGQTYEKKIASILTDLPGSMSCHPNSKDSPTLPESSVTDMGYYSGQTAHGHHEYYQSQPYGQPMNSYHHQFNLNGMGAAGAYATKSEYPYTNGYRQYGHYNRDHLQASPPGSVKEEPEPEVRMVNGKPKKIRKPRTIYSSYQLAALQRRFQKAQYLALPERAELAAQLGLTQTQVKIWFQNRRSKFKKLYKNGEVPLEHSPNASDSMACNSPPSPAVWDNSSTPQNTPISRPQVPQPTHSSSPPYLEDYNNHWYQQGSHLQHPGAVHHPVPQQSVGAVY"
     misc_feature    195..446
                     /gene="dlx3b"
                     /gene_synonym="dlx3"
                     /note="Homeobox protein distal-less-like N terminal;
                     Region: DLL_N; pfam12413"
                     /db_xref="CDD:432536"
     misc_feature    order(510..524,528..530,579..581,597..599,636..638,
                     642..647,654..659,663..671,675..680)
                     /gene="dlx3b"
                     /gene_synonym="dlx3"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238039"
     misc_feature    516..677
                     /gene="dlx3b"
                     /gene_synonym="dlx3"
                     /note="Homeobox domain; Region: Homeobox; pfam00046"
                     /db_xref="CDD:425441"
     misc_feature    order(516..518,525..527,645..647,654..659,666..668)
                     /gene="dlx3b"
                     /gene_synonym="dlx3"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:238039"
     exon            454..638
                     /gene="dlx3b"
                     /gene_synonym="dlx3"
                     /inference="alignment:Splign:2.0.8"
     exon            639..1621
                     /gene="dlx3b"
                     /gene_synonym="dlx3"
                     /inference="alignment:Splign:2.0.8"
ORIGIN      
ttcaaagagcgcgcacacagcagttctgcgtcgcgaatttgctttgcacaatccgcagaagaaaggatccaccagtggactttctttattctggggggactgctttcacaatgagcgccggacagacgtacgagaagaagattgcgagtattttgaccgatctcccaggatctatgagttgccatccgaactccaaggactcccctactctgcccgagtcgtccgtgacggacatgggctactacagtggacagacggcccacggccatcatgaatattatcagagtcagccgtacgggcagcccatgaactcttaccatcaccagtttaatctgaacggaatgggagctgctggagcgtatgccaccaaatctgaatacccatacacgaatggctacagacagtacggacattacaacagagatcacctgcaagcttcacctccgggctcagtgaaagaggagccagagccggaggttcgtatggtaaatggaaagccgaaaaagattcgcaagccgaggacgatctactctagctaccagcttgctgctctgcagagacgcttccagaaggcacaatacctcgccctgcctgaaagagcggagctggcggctcagcttggccttactcagacgcaggtcaagatctggttccagaaccggagatccaagttcaagaagctgtacaaaaacggcgaggttcccttggagcacagccccaatgccagcgactccatggcctgcaactccccgccatcgcccgctgtctgggacaacagcagcacccctcagaacaccccgatcagcagacctcaggtgccgcagccgacgcacagttcatcgccgccgtacctggaggattataataaccactggtaccagcagggatcacacctacaacacccgggagccgtgcaccacccagtcccgcagcaaagcgtgggagctgtttattaacactgactcaagagcagatttctgtcttcggttttatttcaaacgaggtctctccacaatgactctgcagagaaaacgatgactggaccgggagacaaacctgagatgaaacattgctgtgttttttttttgttttttttttttagatgatcaagaatgtttcagaactgggtttccattcacaaaagcacataagggatttctgatcacttgtggcagcatatttaacggacatctggcgtgtttttaaattatttatcgcttcagttttttccttaccttcttttgtaaatgaataaatggtaaatatgcaagtttttttttaaataaataagatgcctatacacaaaccgaataatagcaaaaagaaaaacagaaaaacaaaacaaaaaacaaaactgtgcggttgatccatgctacatcaaatcttgtgggcttgtagagagcgctcaaaacaactcaggtcatatttatatggatttgtacaaaatgtcgaaggctgtaaatatgtgtttatatgcagaaccactatgatcatatttgttcaaacggaacgactgcactgtggtgctttcaaaaaccttctttgttttttgttttttttatattcatgtaattagtccacttgttgccttcctgtcaattgaataaaggtgttaattgtaaaaaaaaaaaaaaaaaaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]