GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-04-27 10:01:54, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       NM_001194880             663 bp    mRNA    linear   PRI 05-JUL-2020
DEFINITION  Macaca mulatta claudin 24 (CLDN24), mRNA.
ACCESSION   NM_001194880 XM_002804270
VERSION     NM_001194880.2
KEYWORDS    RefSeq.
SOURCE      Macaca mulatta (Rhesus monkey)
  ORGANISM  Macaca mulatta
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
COMMENT     INFERRED REFSEQ: This record is predicted by genome sequence
            analysis and is not yet supported by experimental evidence. The
            reference sequence was derived from QNVO02000369.1.
            
            On Jun 30, 2017 this sequence version replaced NM_001194880.1.
            
            Sequence Note: The RefSeq transcript and protein were derived from
            genomic sequence to make the sequence consistent with the reference
            genome assembly. The genomic coordinates used for the transcript
            record were based on alignments.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-663               QNVO02000369.1     23346220-23346882   c
FEATURES             Location/Qualifiers
     source          1..663
                     /organism="Macaca mulatta"
                     /mol_type="mRNA"
                     /db_xref="taxon:9544"
                     /chromosome="5"
                     /map="5"
     gene            1..663
                     /gene="CLDN24"
                     /note="claudin 24"
                     /db_xref="GeneID:100423881"
                     /db_xref="VGNC:VGNC:71381"
     CDS             1..663
                     /gene="CLDN24"
                     /codon_start=1
                     /product="putative claudin-24"
                     /protein_id="NP_001181809.1"
                     /db_xref="GeneID:100423881"
                     /db_xref="VGNC:VGNC:71381"
                     /translation="
MALIFRIVMQSVGLLLSFLGWILSIITTYLPHWKNLNLDLNEMENWTMGLWQTCVTQEEVGMQCKDFDSFLALPAELRVSRILMFLSNGLGFLGLLVSGFGLDCLRIGEGQRDLKRRLLILGGVLSWASGITALVPVSWVAHKTVQEFWDENVPDFVPRWEFGEALFLGWFAGLSLLLGGCLLNCAACSSHALLASGHYAVAQIQTQCSYLEDGTADPQV"
     misc_feature    37..516
                     /gene="CLDN24"
                     /note="PMP-22/EMP/MP20/Claudin family; Region:
                     PMP22_Claudin; cl21598"
                     /db_xref="CDD:451326"
     exon            1..663
                     /gene="CLDN24"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
atggctttaatctttagaatagtgatgcaatctgttgggcttttactatctttcctgggatggattttatccattattacaacttatttgccacactggaagaacctcaacctggacttaaatgaaatggaaaactggaccatgggactctggcaaacctgcgtcacccaagaggaagtgggaatgcaatgcaaggactttgactccttcctggctttgcctgctgaactcagggtctccaggatcttaatgtttctatcaaacgggctgggatttctgggcctgctggtctctgggtttggcctggactgtttgagaattggagagggtcagagagatctcaagaggcgactgctgatcctgggaggagttctgtcctgggcctcgggaatcacagccctggttcctgtctcttgggttgcccacaagacggttcaggagttctgggatgagaacgtcccagactttgtccccaggtgggagtttggggaggccctctttctgggctggtttgctggactttctcttctactgggagggtgtctgctcaactgtgcagcctgttccagccatgctctcctagcttcgggccactatgcagtggcgcaaatacaaactcagtgttcctacctggaagacgggacggcagatcctcaagtgtaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]