2024-04-18 05:32:59, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_001191995 869 bp mRNA linear ROD 21-MAR-2023 DEFINITION Rattus norvegicus brain specific homeobox (Bsx), mRNA. ACCESSION NM_001191995 XM_576393 VERSION NM_001191995.1 KEYWORDS RefSeq; RefSeq Select. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE 1 (bases 1 to 869) AUTHORS Carstensen MB, Hertz H, Bering T, Moller M, Rohde K, Klein DC, Coon SL and Rath MF. TITLE Circadian regulation and molecular role of the Bsx homeobox gene in the adult pineal gland JOURNAL J Pineal Res 68 (2), e12629 (2020) PUBMED 31808568 REMARK GeneRIF: Circadian regulation and molecular role of the Bsx homeobox gene in the adult pineal gland. REFERENCE 2 (bases 1 to 869) AUTHORS Lage R, Vazquez MJ, Varela L, Saha AK, Vidal-Puig A, Nogueiras R, Dieguez C and Lopez M. TITLE Ghrelin effects on neuropeptides in the rat hypothalamus depend on fatty acid metabolism actions on BSX but not on gender JOURNAL FASEB J 24 (8), 2670-2679 (2010) PUBMED 20335227 REMARK GeneRIF: Ghrelin-induced changes in the AMPK-CPT1 pathway are associated with increased levels of AgRP and NPY mRNA expression through modulation of BSX, pCREB, and FoxO1 in a gender-independent manner. REFERENCE 3 (bases 1 to 869) AUTHORS McArthur T and Ohtoshi A. TITLE A brain-specific homeobox gene, Bsx, is essential for proper postnatal growth and nursing JOURNAL Mol Cell Biol 27 (14), 5120-5127 (2007) PUBMED 17485440 REFERENCE 4 (bases 1 to 869) AUTHORS Sakkou M, Wiedmer P, Anlag K, Hamm A, Seuntjens E, Ettwiller L, Tschop MH and Treier M. TITLE A role for brain-specific homeobox factor Bsx in the control of hyperphagia and locomotory behavior JOURNAL Cell Metab 5 (6), 450-463 (2007) PUBMED 17550780 REFERENCE 5 (bases 1 to 869) AUTHORS Chu HY and Ohtoshi A. TITLE Cloning and functional analysis of hypothalamic homeobox gene Bsx1a and its isoform, Bsx1b JOURNAL Mol Cell Biol 27 (10), 3743-3749 (2007) PUBMED 17353277 COMMENT INFERRED REFSEQ: This record is predicted by genome sequence analysis and is not yet supported by experimental evidence. The reference sequence was derived from JACYVU010000198.1. On Jul 17, 2010 this sequence version replaced XM_576393.2. Sequence Note: The RefSeq transcript and protein were derived from genomic sequence to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on alignments. ##RefSeq-Attributes-START## RefSeq Select criteria :: based on single protein-coding transcript ##RefSeq-Attributes-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-307 JACYVU010000198.1 3067416-3067722 308-504 JACYVU010000198.1 3069608-3069804 505-869 JACYVU010000198.1 3070808-3071172 FEATURES Location/Qualifiers source 1..869 /organism="Rattus norvegicus" /mol_type="mRNA" /strain="BN" /db_xref="taxon:10116" /chromosome="8" /map="8q22" gene 1..869 /gene="Bsx" /gene_synonym="RGD1565120" /note="brain specific homeobox" /db_xref="GeneID:500982" /db_xref="RGD:1565120" exon 1..307 /gene="Bsx" /gene_synonym="RGD1565120" /inference="alignment:Splign:2.1.0" CDS 46..744 /gene="Bsx" /gene_synonym="RGD1565120" /codon_start=1 /product="brain-specific homeobox protein homolog" /protein_id="NP_001178924.1" /db_xref="GeneID:500982" /db_xref="RGD:1565120" /translation="
MNLNFTSPLHPASSQRPTSFFIEDILLHKPKPLREVAPDHFASSLASRVPLLDYGYPLMPTPTLLTPHTHHPLHKGEHHHPYFLATSGMPVPALFPHPQHAELPGKHCRRRKARTVFSDSQLSGLEKRFEIQRYLSTPERVELATALSLSETQVKTWFQNRRMKHKKQLRKSQDEPKAADGPESPEGSPRAPEGAPADARLSLPAGAFVLTEPEDEVDIGDEGELSSGPHVL"
misc_feature order(376..390,394..396,445..447,463..465,502..504, 508..513,520..525,529..537,541..546) /gene="Bsx" /gene_synonym="RGD1565120" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature order(382..384,391..393,511..513,520..525,532..534) /gene="Bsx" /gene_synonym="RGD1565120" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 385..543 /gene="Bsx" /gene_synonym="RGD1565120" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:425441" exon 308..504 /gene="Bsx" /gene_synonym="RGD1565120" /inference="alignment:Splign:2.1.0" exon 505..869 /gene="Bsx" /gene_synonym="RGD1565120" /inference="alignment:Splign:2.1.0" ORIGIN
ctgcactttgtccgggccctcgccccgtgccaggcgctctgcaagatgaatctcaacttcacttcccctctccatccagcatcttctcagaggcccacgtcgtttttcatcgaggacattctgctacacaagcccaagccgttgagggaagtggcccctgaccactttgccagctctctggcctctagggtgcctttgctagactatggctacccccttatgcccacacccaccctcctcacccctcacactcatcatcctctgcataagggggagcatcatcacccttatttcctggccacctcagggatgccggtcccggctctgttcccgcacccgcagcatgcagagctacccgggaagcactgccgccgccgcaaagctcgcacggtgttttctgactcgcagctctccggcctggagaaaaggttcgaaatccagcgctacctgtcgacaccagagcgtgtggagctggccactgctctcagcctctctgagactcaggtgaaaacgtggttccagaaccggcggatgaagcataaaaaacagctgaggaaaagtcaagacgaacccaaagccgcagacgggcctgagagcccagagggcagccctcgtgctcccgagggcgcgcccgccgacgctcggctgagtttgccggccggtgccttcgtgcttacagagccggaggacgaggtggacattggggacgaaggcgagctcagctcagggccgcacgtgctctgagtggccaggctgggaagggagacccgggcgaggaggctgtggggccagacccggttctttccgggcgagaagactcgcggagactctagactgttcctgcggcctggactggaagaaagaaaggc
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]