2024-04-20 03:56:21, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_001191649 973 bp mRNA linear ROD 23-MAR-2023 DEFINITION Rattus norvegicus homeo box B8 (Hoxb8), mRNA. ACCESSION NM_001191649 XM_220888 VERSION NM_001191649.1 KEYWORDS RefSeq; RefSeq Select. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE 1 (bases 1 to 973) AUTHORS Holstege JC, de Graaff W, Hossaini M, Cardona Cano S, Jaarsma D, van den Akker E and Deschamps J. TITLE Loss of Hoxb8 alters spinal dorsal laminae and sensory responses in mice JOURNAL Proc Natl Acad Sci U S A 105 (17), 6338-6343 (2008) PUBMED 18430798 REFERENCE 2 (bases 1 to 973) AUTHORS El-Mounayri O, Triplett JW, Yates CW and Herring BP. TITLE Regulation of smooth muscle-specific gene expression by homeodomain proteins, Hoxa10 and Hoxb8 JOURNAL J Biol Chem 280 (27), 25854-25863 (2005) PUBMED 15886193 REFERENCE 3 (bases 1 to 973) AUTHORS Medina-Martinez O and Ramirez-Solis R. TITLE In vivo mutagenesis of the Hoxb8 hexapeptide domain leads to dominant homeotic transformations that mimic the loss-of-function mutations in genes of the Hoxb cluster JOURNAL Dev Biol 264 (1), 77-90 (2003) PUBMED 14623233 REFERENCE 4 (bases 1 to 973) AUTHORS Greer JM and Capecchi MR. TITLE Hoxb8 is required for normal grooming behavior in mice JOURNAL Neuron 33 (1), 23-34 (2002) PUBMED 11779477 REFERENCE 5 (bases 1 to 973) AUTHORS Knoepfler PS, Sykes DB, Pasillas M and Kamps MP. TITLE HoxB8 requires its Pbx-interaction motif to block differentiation of primary myeloid progenitors and of most cell line models of myeloid differentiation JOURNAL Oncogene 20 (39), 5440-5448 (2001) PUBMED 11571641 REFERENCE 6 (bases 1 to 973) AUTHORS Medina-Martinez O, Bradley A and Ramirez-Solis R. TITLE A large targeted deletion of Hoxb1-Hoxb9 produces a series of single-segment anterior homeotic transformations JOURNAL Dev Biol 222 (1), 71-83 (2000) PUBMED 10885747 REFERENCE 7 (bases 1 to 973) AUTHORS van den Akker E, Reijnen M, Korving J, Brouwer A, Meijlink F and Deschamps J. TITLE Targeted inactivation of Hoxb8 affects survival of a spinal ganglion and causes aberrant limb reflexes JOURNAL Mech Dev 89 (1-2), 103-114 (1999) PUBMED 10559485 REFERENCE 8 (bases 1 to 973) AUTHORS Iimura T, Oida S, Takeda K, Maruoka Y and Sasaki S. TITLE Changes in homeobox-containing gene expression during ectopic bone formation induced by bone morphogenetic protein JOURNAL Biochem Biophys Res Commun 201 (2), 980-987 (1994) PUBMED 7911662 REFERENCE 9 (bases 1 to 973) AUTHORS Chung SY, Dai PH, Lei J, Riviere M, Levan G, Szpirer J and Szpirer C. TITLE Chromosomal assignment of seven rat homeobox genes to rat chromosomes 3, 4, 7, and 10 JOURNAL Mamm Genome 4 (9), 537-540 (1993) PUBMED 7906969 REFERENCE 10 (bases 1 to 973) AUTHORS Falzon M and Chung SY. TITLE The expression of rat homeobox-containing genes is developmentally regulated and tissue specific JOURNAL Development 103 (3), 601-610 (1988) PUBMED 2907739 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from JACYVU010000220.1. On Jul 17, 2010 this sequence version replaced XM_220888.4. Sequence Note: The RefSeq transcript and protein were derived from genomic sequence to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on alignments. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##RefSeq-Attributes-START## RefSeq Select criteria :: based on conservation, expression, longest protein ##RefSeq-Attributes-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-424 JACYVU010000220.1 38073745-38074168 425-973 JACYVU010000220.1 38074948-38075496 FEATURES Location/Qualifiers source 1..973 /organism="Rattus norvegicus" /mol_type="mRNA" /strain="BN" /db_xref="taxon:10116" /chromosome="10" /map="10q26" gene 1..973 /gene="Hoxb8" /gene_synonym="Hox2r1a" /note="homeo box B8" /db_xref="GeneID:24457" /db_xref="RGD:1586211" CDS 1..732 /gene="Hoxb8" /gene_synonym="Hox2r1a" /note="Hox2.4 homeobox homolog; homeobox gene B8; homeobox protein R1a" /codon_start=1 /product="homeobox protein Hox-B8" /protein_id="NP_001178578.1" /db_xref="GeneID:24457" /db_xref="RGD:1586211" /translation="
MSSYFVNSLFSKYKTGESLRPNYYDCGFAQDLGGRPTVVYGPSSGGSFQHPSQIQEFYHGPSSLSTAPYQQNPCAVACHGDPGNFYGYDPLQRQSLFGAQDPDLVQYADCKLAAASGLGEEAEGSEQSPSPTQLFPWMRPQAAAGRRRGRQTYSRYQTLELEKEFLFNPYLTRKRRIEVSHALGLTERQVKIWFQNRRMKWKKENNKDKFPSSKCEQEELEKEKLERAPETAEQGDAQKGDKK"
misc_feature order(439..453,457..459,508..510,526..528,565..567, 571..576,583..588,592..600,604..609) /gene="Hoxb8" /gene_synonym="Hox2r1a" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature order(445..447,454..456,574..576,583..588,595..597) /gene="Hoxb8" /gene_synonym="Hox2r1a" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 448..606 /gene="Hoxb8" /gene_synonym="Hox2r1a" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:425441" exon 1..424 /gene="Hoxb8" /gene_synonym="Hox2r1a" /inference="alignment:Splign:2.1.0" exon 425..973 /gene="Hoxb8" /gene_synonym="Hox2r1a" /inference="alignment:Splign:2.1.0" ORIGIN
atgagctcttatttcgtcaactcactgttctccaaatacaaaaccggggagtccctgcgccccaattattatgactgcggcttcgcccaggacctgggcggccgacccaccgtggtgtacggtcccagcagcggcggcagcttccagcacccttcgcaaatccaggagttctaccacgggccatcgtcgctgtccacggctccctaccagcagaacccgtgcgccgtggcgtgccacggggacccgggcaacttctacggctacgaccctctgcagcgccagagcctgttcggtgcgcaggatccagacctggtgcagtacgcagactgcaagctcgcggcagccagcggcctgggcgaggaggccgaggggtctgagcagagcccgtcgcccacacagctcttcccctggatgcgccctcaagcagccgccggacgcaggcgaggccgccagacctacagccgctaccagaccctggagctggagaaggagttcctatttaatccctatctgactcgcaagcggaggatcgaggtatcgcacgcgctgggactgacagaaagacaggtcaaaatctggttccagaatcggagaatgaagtggaaaaaggagaacaacaaagacaagttccccagcagtaaatgcgagcaggaggagctggagaaagagaagctggagcgggcgccagagaccgccgagcagggcgatgcgcagaagggtgacaaaaagtaggctccagctgggactgctcgggcccggactagcccgcacgtccgccggtccctcccgcgaccacgccgccgccgcccgccccccgcctccgagagctccggccccgcgagcggagccaggagctgggcctcccaccgcagcgtcccccgccgcgccagtccccgctagtggtagtatctcgtaatagcttctgtgtgtgagctaccgtggatctccttcccttctcttgggggtccgaggg
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]