2025-07-15 21:46:23, GGRNA.v2 : RefSeq release 229 (Mar, 2025)
LOCUS NM_001182894 852 bp mRNA linear PLN 17-DEC-2024 DEFINITION Saccharomyces cerevisiae S288C porin POR1 (POR1), partial mRNA. ACCESSION NM_001182894 VERSION NM_001182894.1 DBLINK BioProject: PRJNA128 KEYWORDS RefSeq. SOURCE Saccharomyces cerevisiae S288C ORGANISM Saccharomyces cerevisiae S288C Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces. REFERENCE 1 (bases 1 to 852) AUTHORS Engel,S.R., Wong,E.D., Nash,R.S., Aleksander,S., Alexander,M., Douglass,E., Karra,K., Miyasato,S.R., Simison,M., Skrzypek,M.S., Weng,S. and Cherry,J.M. TITLE New data and collaborations at the Saccharomyces Genome Database: updated reference genome, alleles, and the Alliance of Genome Resources JOURNAL Genetics 220 (4) (2022) PUBMED 34897464 REFERENCE 2 (bases 1 to 852) AUTHORS Philippsen,P., Kleine,K., Pohlmann,R., Dusterhoft,A., Hamberg,K., Hegemann,J.H., Obermaier,B., Urrestarazu,L.A., Aert,R., Albermann,K., Altmann,R., Andre,B., Baladron,V., Ballesta,J.P., Becam,A.M., Beinhauer,J., Boskovic,J., Buitrago,M.J., Bussereau,F., Coster,F., Crouzet,M., D'Angelo,M., Dal Pero,F., De Antoni,A., Hani,J. et al. TITLE The nucleotide sequence of Saccharomyces cerevisiae chromosome XIV and its evolutionary implications JOURNAL Nature 387 (6632 SUPPL), 93-98 (1997) PUBMED 9169873 REFERENCE 3 (bases 1 to 852) AUTHORS Goffeau,A., Barrell,B.G., Bussey,H., Davis,R.W., Dujon,B., Feldmann,H., Galibert,F., Hoheisel,J.D., Jacq,C., Johnston,M., Louis,E.J., Mewes,H.W., Murakami,Y., Philippsen,P., Tettelin,H. and Oliver,S.G. TITLE Life with 6000 genes JOURNAL Science 274 (5287), 546 (1996) PUBMED 8849441 REFERENCE 4 (bases 1 to 852) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (17-DEC-2024) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 5 (bases 1 to 852) CONSRTM Saccharomyces Genome Database TITLE Direct Submission JOURNAL Submitted (04-MAY-2012) Department of Genetics, Stanford University, Stanford, CA 94305-5120, USA REMARK Protein update by submitter REFERENCE 6 (bases 1 to 852) CONSRTM Saccharomyces Genome Database TITLE Direct Submission JOURNAL Submitted (31-MAR-2011) Department of Genetics, Stanford University, Stanford, CA 94305-5120, USA REMARK Sequence update by submitter REFERENCE 7 (bases 1 to 852) CONSRTM Saccharomyces Genome Database TITLE Direct Submission JOURNAL Submitted (26-MAY-2010) Department of Genetics, Stanford University, Stanford, CA 94305-5120, USA REMARK Sequence update by submitter REFERENCE 8 (bases 1 to 852) CONSRTM Saccharomyces Genome Database TITLE Direct Submission JOURNAL Submitted (14-DEC-2009) Department of Genetics, Stanford University, Stanford, CA 94305-5120, USA COMMENT REVIEWED REFSEQ: This record has been curated by SGD. This record is derived from an annotated genomic sequence (NC_001146). ##Genome-Annotation-Data-START## Annotation Provider :: SGD Annotation Status :: Full Annotation Annotation Version :: R64-4-1 URL :: http://www.yeastgenome.org/ ##Genome-Annotation-Data-END## COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..852 /organism="Saccharomyces cerevisiae S288C" /mol_type="mRNA" /strain="S288C" /db_xref="taxon:559292" /chromosome="XIV" gene <1..>852 /gene="POR1" /locus_tag="YNL055C" /gene_synonym="OMP2" /db_xref="GeneID:855669" CDS 1..852 /gene="POR1" /locus_tag="YNL055C" /gene_synonym="OMP2" /experiment="EXISTENCE:direct assay:GO:0005737 cytoplasm [PMID:22842922]" /experiment="EXISTENCE:direct assay:GO:0005739 mitochondrion [PMID:16823961|PMID:24769239]" /experiment="EXISTENCE:direct assay:GO:0005741 mitochondrial outer membrane [PMID:7499333|PMID:16689936|PMID:16407407]" /experiment="EXISTENCE:direct assay:GO:0006811 monoatomic ion transport [PMID:9593723]" /experiment="EXISTENCE:direct assay:GO:0008308 voltage-gated monoatomic anion channel activity [PMID:9593723]" /experiment="EXISTENCE:direct assay:GO:0017128 phospholipid scramblase activity [PMID:38065946]" /experiment="EXISTENCE:direct assay:GO:0048039 ubiquinone binding [PMID:38906315|PMID:28051849]" /experiment="EXISTENCE:mutant phenotype:GO:0005741 mitochondrial outer membrane [PMID:38065946]" /experiment="EXISTENCE:mutant phenotype:GO:0006915 apoptotic process [PMID:17822411]" /experiment="EXISTENCE:mutant phenotype:GO:0007005 mitochondrion organization [PMID:11488609]" /experiment="EXISTENCE:mutant phenotype:GO:0042307 positive regulation of protein import into nucleus [PMID:29359182]" /experiment="EXISTENCE:mutant phenotype:GO:0045332 phospholipid translocation [PMID:38065946]" /experiment="EXISTENCE:mutant phenotype:GO:0045454 cell redox homeostasis [PMID:18768136]" /experiment="EXISTENCE:mutant phenotype:GO:0051027 DNA transport [PMID:19056337]" /experiment="EXISTENCE:physical interaction:GO:0005739 mitochondrion [PMID:16962558]" /experiment="EXISTENCE:physical interaction:GO:0044289 mitochondrial inner-outer membrane contact site [PMID:37073556]" /note="Mitochondrial porin and phospholipid scramblase; voltage-dependent anion channel in the outer mitochondrial membrane required for maintenance of mitochondrial osmotic stability and membrane permeability; scramblase involved in mitochondrial transbilayer translocation of phospholipids; ubiquinone binding protein; couples glutathione pools of the intermembrane space and the cytosol; phosphorylated; protein abundance increases in response to DNA replication stress; orthologous to human VDAC1 and 2" /codon_start=1 /product="porin POR1" /protein_id="NP_014343.1" /db_xref="GeneID:855669" /db_xref="SGD:S000005000" /translation="
MSPPVYSDISRNINDLLNKDFYHATPAAFDVQTTTANGIKFSLKAKQPVKDGPLSTNVEAKLNDKQTGLGLTQGWSNTNNLQTKLEFANLTPGLKNELITSLTPGVAKSAVLNTTFTQPFFTARGAFDLCLKSPTFVGDLTMAHEGIVGGAEFGYDISAGSISRYAMALSYFAKDYSLGATLNNEQITTVDFFQNVNAFLQVGAKATMNCKLPNSNVNIEFATRYLPDASSQVKAKVSDSGIVTLAYKQLLRPGVTLGVGSSFDALKLSEPVHKLGWSLSFDA"
misc_feature 7..846 /gene="POR1" /locus_tag="YNL055C" /gene_synonym="OMP2" /note="Voltage-dependent anion channel of the outer mitochondrial membrane; Region: Porin3_VDAC; cd07306" /db_xref="CDD:132767" misc_feature order(43..45,55..57,136..138,181..183,250..252,454..456, 844..846) /gene="POR1" /locus_tag="YNL055C" /gene_synonym="OMP2" /note="putative determinants of voltage gating [active]" /db_xref="CDD:132767" misc_feature order(79..81,85..87,769..771,775..777,829..831) /gene="POR1" /locus_tag="YNL055C" /gene_synonym="OMP2" /note="putative dimerization interface [polypeptide binding]; other site" /db_xref="CDD:132767" ORIGIN
atgtctcctccagtttacagcgatatctccagaaatatcaatgacctattgaacaaggatttctatcatgctaccccagctgcctttgatgtgcaaacaacaaccgccaatggcattaagttctcattgaaggctaaacagcctgtcaaagacggtccactgtctactaacgtggaagcaaagttgaatgacaagcaaaccggcttgggtctaactcaaggctggtctaacacaaacaacttgcaaaccaaattagagtttgccaacttgacccctggtctaaagaacgaattgatcacttctttgactccaggcgtcgccaagtccgccgtcttaaacactacgttcacacaacctttcttcaccgcaagaggtgcctttgacttgtgtttgaagtcaccaacatttgttggtgacttaactatggcccacgaaggtattgttggtggcgcagagtttggttacgatatcagcgccggttccatttctcgttatgccatggctttaagttatttcgccaaagactactccttgggcgctacattgaacaacgagcaaataactaccgttgacttcttccaaaacgtcaacgcctttttacaggtcggtgctaaggctacaatgaactgcaaactacctaactccaatgtcaacatcgaattcgccactagatatttgcctgatgcatcttcccaagttaaggctaaggtgtccgattccggtattgtcactttggcttacaagcaattgttaagacctggcgtcactctgggtgtcggttcctctttcgatgctttgaagttgtctgaacctgttcacaagctaggttggtctttgtccttcgacgcttga
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]