2025-07-15 21:31:40, GGRNA.v2 : RefSeq release 229 (Mar, 2025)
LOCUS NM_001181898 576 bp mRNA linear PLN 17-DEC-2024 DEFINITION Saccharomyces cerevisiae S288C flavin-dependent quinone reductase (LOT6), partial mRNA. ACCESSION NM_001181898 VERSION NM_001181898.1 DBLINK BioProject: PRJNA128 KEYWORDS RefSeq. SOURCE Saccharomyces cerevisiae S288C ORGANISM Saccharomyces cerevisiae S288C Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces. REFERENCE 1 (bases 1 to 576) AUTHORS Engel,S.R., Wong,E.D., Nash,R.S., Aleksander,S., Alexander,M., Douglass,E., Karra,K., Miyasato,S.R., Simison,M., Skrzypek,M.S., Weng,S. and Cherry,J.M. TITLE New data and collaborations at the Saccharomyces Genome Database: updated reference genome, alleles, and the Alliance of Genome Resources JOURNAL Genetics 220 (4) (2022) PUBMED 34897464 REFERENCE 2 (bases 1 to 576) AUTHORS Johnston,M., Hillier,L., Riles,L., Albermann,K., Andre,B., Ansorge,W., Benes,V., Bruckner,M., Delius,H., Dubois,E., Dusterhoft,A., Entian,K.D., Floeth,M., Goffeau,A., Hebling,U., Heumann,K., Heuss-Neitzel,D., Hilbert,H., Hilger,F., Kleine,K., Kotter,P., Louis,E.J., Messenguy,F., Mewes,H.W., Hoheisel,J.D. et al. TITLE The nucleotide sequence of Saccharomyces cerevisiae chromosome XII JOURNAL Nature 387 (6632 SUPPL), 87-90 (1997) PUBMED 9169871 REFERENCE 3 (bases 1 to 576) AUTHORS Goffeau,A., Barrell,B.G., Bussey,H., Davis,R.W., Dujon,B., Feldmann,H., Galibert,F., Hoheisel,J.D., Jacq,C., Johnston,M., Louis,E.J., Mewes,H.W., Murakami,Y., Philippsen,P., Tettelin,H. and Oliver,S.G. TITLE Life with 6000 genes JOURNAL Science 274 (5287), 546 (1996) PUBMED 8849441 REFERENCE 4 (bases 1 to 576) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (17-DEC-2024) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 5 (bases 1 to 576) CONSRTM Saccharomyces Genome Database TITLE Direct Submission JOURNAL Submitted (16-JAN-2015) Department of Genetics, Stanford University, Stanford, CA, USA REMARK Protein update by submitter REFERENCE 6 (bases 1 to 576) CONSRTM Saccharomyces Genome Database TITLE Direct Submission JOURNAL Submitted (06-FEB-2013) Department of Genetics, Stanford University, Stanford, CA, USA REMARK Protein update by submitter REFERENCE 7 (bases 1 to 576) CONSRTM Saccharomyces Genome Database TITLE Direct Submission JOURNAL Submitted (04-MAY-2012) Department of Genetics, Stanford University, Stanford, CA, USA REMARK Protein update by submitter REFERENCE 8 (bases 1 to 576) CONSRTM Saccharomyces Genome Database TITLE Direct Submission JOURNAL Submitted (31-MAR-2011) Department of Genetics, Stanford University, Stanford, CA, USA REMARK Sequence update by submitter REFERENCE 9 (bases 1 to 576) CONSRTM Saccharomyces Genome Database TITLE Direct Submission JOURNAL Submitted (14-DEC-2009) Department of Genetics, Stanford University, Stanford, CA, USA COMMENT REVIEWED REFSEQ: This record has been curated by SGD. This record is derived from an annotated genomic sequence (NC_001144). ##Genome-Annotation-Data-START## Annotation Provider :: SGD Annotation Status :: Full Annotation Annotation Version :: R64-4-1 URL :: http://www.yeastgenome.org/ ##Genome-Annotation-Data-END## COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..576 /organism="Saccharomyces cerevisiae S288C" /mol_type="mRNA" /strain="S288C" /db_xref="taxon:559292" /chromosome="XII" gene <1..>576 /gene="LOT6" /locus_tag="YLR011W" /db_xref="GeneID:850698" CDS 1..576 /gene="LOT6" /locus_tag="YLR011W" /EC_number="1.5.1.39" /experiment="EXISTENCE:direct assay:GO:0003955 NAD(P)H dehydrogenase (quinone) activity [PMID:17298444]" /experiment="EXISTENCE:direct assay:GO:0005634 nucleus [PMID:17298444|PMID:14562095]" /experiment="EXISTENCE:direct assay:GO:0005737 cytoplasm [PMID:14562095]" /experiment="EXISTENCE:direct assay:GO:0005829 cytosol [PMID:17298444]" /experiment="EXISTENCE:mutant phenotype:GO:0003955 NAD(P)H dehydrogenase (quinone) activity [PMID:17298444]" /experiment="EXISTENCE:mutant phenotype:GO:0006915 apoptotic process [PMID:19709309]" /experiment="EXISTENCE:mutant phenotype:GO:0034599 cellular response to oxidative stress [PMID:17298444]" /note="FMN-dependent NAD(P)H:quinone reductase; role in apoptosis-like cell death; may be involved in quinone detoxification; expression elevated at low temperature; sequesters the Cin5p transcription factor in the cytoplasm in complex with the proteasome under reducing conditions" /codon_start=1 /product="flavin-dependent quinone reductase" /protein_id="NP_013111.1" /db_xref="GeneID:850698" /db_xref="SGD:S000004001" /translation="
MKVGIIMGSVRAKRVCPEIAAYVKRTIENSEELIDQKLKIQVVDLQQIALPLYEDDDELIPAQIKSVDEYADSKTRSWSRIVNALDIIVFVTPQYNWGYPAALKNAIDRLYHEWHGKPALVVSYGGHGGSKCNDQLQEVLHGLKMNVIGGVAVKIPVGTIPLPEDIVPQLSVHNEEILQLLASCIETTRNK"
misc_feature 1..477 /gene="LOT6" /locus_tag="YLR011W" /note="NADPH-dependent FMN reductase; Region: FMN_red; pfam03358" /db_xref="CDD:427259" ORIGIN
atgaaagtgggtattataatgggttctgtgagggcaaagagggtatgcccagaaattgcagcatacgtaaaacgtacaattgaaaatagcgaagaattaatagaccagaagctgaaaatacaagtagtagatttacaacagattgctcttcccttatatgaagatgatgacgaactgatccctgcgcaaataaagagcgtggatgagtatgcagacagcaaaactcgatcgtggagtcgcatcgtaaatgcattagatattattgtattcgttacacctcaatataattgggggtatccagcagccttaaaaaatgcaattgatcgtctttaccatgaatggcacggaaaacctgccctggtggtaagctacggcggtcatggcggtagtaagtgtaatgaccaacttcaagaggtactacatggtttgaagatgaatgttataggtggagtggcggtgaaaataccggtaggtacgataccgttacccgaggacattgtaccacaactcagcgtgcacaatgaagagatcctgcaattactcgcatcgtgcatcgaaacaacgaggaataaataa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]