2025-07-15 15:33:02, GGRNA.v2 : RefSeq release 229 (Mar, 2025)
LOCUS NM_001179310 1203 bp mRNA linear PLN 17-DEC-2024 DEFINITION Saccharomyces cerevisiae S288C NADPH dehydrogenase (OYE2), partial mRNA. ACCESSION NM_001179310 VERSION NM_001179310.1 DBLINK BioProject: PRJNA128 KEYWORDS RefSeq. SOURCE Saccharomyces cerevisiae S288C ORGANISM Saccharomyces cerevisiae S288C Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces. REFERENCE 1 (bases 1 to 1203) AUTHORS Engel,S.R., Wong,E.D., Nash,R.S., Aleksander,S., Alexander,M., Douglass,E., Karra,K., Miyasato,S.R., Simison,M., Skrzypek,M.S., Weng,S. and Cherry,J.M. TITLE New data and collaborations at the Saccharomyces Genome Database: updated reference genome, alleles, and the Alliance of Genome Resources JOURNAL Genetics 220 (4) (2022) PUBMED 34897464 REFERENCE 2 (bases 1 to 1203) AUTHORS Goffeau,A., Barrell,B.G., Bussey,H., Davis,R.W., Dujon,B., Feldmann,H., Galibert,F., Hoheisel,J.D., Jacq,C., Johnston,M., Louis,E.J., Mewes,H.W., Murakami,Y., Philippsen,P., Tettelin,H. and Oliver,S.G. TITLE Life with 6000 genes JOURNAL Science 274 (5287), 546 (1996) PUBMED 8849441 REFERENCE 3 (bases 1 to 1203) AUTHORS Johnston,M., Andrews,S., Brinkman,R., Cooper,J., Ding,H., Dover,J., Du,Z., Favello,A., Fulton,L., Gattung,S. et al. TITLE Complete nucleotide sequence of Saccharomyces cerevisiae chromosome VIII JOURNAL Science 265 (5181), 2077-2082 (1994) PUBMED 8091229 REFERENCE 4 (bases 1 to 1203) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (17-DEC-2024) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 5 (bases 1 to 1203) CONSRTM Saccharomyces Genome Database TITLE Direct Submission JOURNAL Submitted (04-MAY-2012) Department of Genetics, Stanford University, Stanford, CA 94305-5120, USA REMARK Protein update by submitter REFERENCE 6 (bases 1 to 1203) CONSRTM Saccharomyces Genome Database TITLE Direct Submission JOURNAL Submitted (31-MAR-2011) Department of Genetics, Stanford University, Stanford, CA 94305-5120, USA REMARK Sequence update by submitter REFERENCE 7 (bases 1 to 1203) CONSRTM Saccharomyces Genome Database TITLE Direct Submission JOURNAL Submitted (11-DEC-2009) Department of Genetics, Stanford University, Stanford, CA 94305-5120, USA COMMENT REVIEWED REFSEQ: This record has been curated by SGD. This record is derived from an annotated genomic sequence (NC_001140). ##Genome-Annotation-Data-START## Annotation Provider :: SGD Annotation Status :: Full Annotation Annotation Version :: R64-4-1 URL :: http://www.yeastgenome.org/ ##Genome-Annotation-Data-END## COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..1203 /organism="Saccharomyces cerevisiae S288C" /mol_type="mRNA" /strain="S288C" /db_xref="taxon:559292" /chromosome="VIII" gene <1..>1203 /gene="OYE2" /locus_tag="YHR179W" /db_xref="GeneID:856584" CDS 1..1203 /gene="OYE2" /locus_tag="YHR179W" /EC_number="1.6.99.1" /experiment="EXISTENCE:direct assay:GO:0003959 NADPH dehydrogenase activity [PMID:8454584]" /experiment="EXISTENCE:direct assay:GO:0005634 nucleus [PMID:14562095]" /experiment="EXISTENCE:direct assay:GO:0005737 cytoplasm [PMID:14562095]" /experiment="EXISTENCE:direct assay:GO:0005739 mitochondrion [PMID:14576278|PMID:16823961]" /experiment="EXISTENCE:mutant phenotype:GO:0006915 apoptotic process [PMID:17897954]" /note="Conserved NADPH oxidoreductase containing flavin mononucleotide (FMN); responsible for geraniol reduction into citronellol during fermentation; homologous to Oye3p with different ligand binding and catalytic properties; may be involved in sterol metabolism, oxidative stress response, and programmed cell death; protein abundance increases in response to DNA replication stress" /codon_start=1 /product="NADPH dehydrogenase" /protein_id="NP_012049.1" /db_xref="GeneID:856584" /db_xref="SGD:S000001222" /translation="
MPFVKDFKPQALGDTNLFKPIKIGNNELLHRAVIPPLTRMRAQHPGNIPNRDWAVEYYAQRAQRPGTLIITEGTFPSPQSGGYDNAPGIWSEEQIKEWTKIFKAIHENKSFAWVQLWVLGWAAFPDTLARDGLRYDSASDNVYMNAEQEEKAKKANNPQHSITKDEIKQYVKEYVQAAKNSIAAGADGVEIHSANGYLLNQFLDPHSNNRTDEYGGSIENRARFTLEVVDAVVDAIGPEKVGLRLSPYGVFNSMSGGAETGIVAQYAYVLGELERRAKAGKRLAFVHLVEPRVTNPFLTEGEGEYNGGSNKFAYSIWKGPIIRAGNFALHPEVVREEVKDPRTLIGYGRFFISNPDLVDRLEKGLPLNKYDRDTFYKMSAEGYIDYPTYEEALKLGWDKN"
misc_feature 46..1116 /gene="OYE2" /locus_tag="YHR179W" /note="Old yellow enzyme (OYE)-like FMN binding domain. OYE was the first flavin-dependent enzyme identified, however its true physiological role remains elusive to this day. Each monomer of OYE contains FMN as a non-covalently bound cofactor, uses NADPH as a...; Region: OYE_like_FMN; cd02933" /db_xref="CDD:239243" misc_feature order(106..108,112..114,217..219,343..345,730..732, 973..975,1036..1038,1042..1050) /gene="OYE2" /locus_tag="YHR179W" /note="FMN binding site [chemical binding]; other site" /db_xref="CDD:239243" misc_feature order(106..108,112..114,217..219,343..345,349..351, 370..372,574..576,583..585,589..591,730..732,751..753, 973..975,1036..1038,1042..1047) /gene="OYE2" /locus_tag="YHR179W" /note="active site" /db_xref="CDD:239243" misc_feature order(112..114,349..351,574..576,583..585,589..591, 1045..1047) /gene="OYE2" /locus_tag="YHR179W" /note="substrate binding site [chemical binding]; other site" /db_xref="CDD:239243" misc_feature 589..591 /gene="OYE2" /locus_tag="YHR179W" /note="catalytic residue [active]" /db_xref="CDD:239243" ORIGIN
atgccatttgttaaggactttaagccacaagctttgggtgacaccaacttattcaaaccaatcaaaattggtaacaatgaacttctacaccgtgctgtcattcctccattgactagaatgagagcccaacatccaggtaatattccaaacagagactgggccgttgaatactacgctcaacgtgctcaaagaccaggaaccttgattatcactgaaggtacctttccctctccacaatctgggggttacgacaatgctccaggtatctggtccgaagaacaaattaaagaatggaccaagattttcaaggctattcatgagaataaatcgttcgcatgggtccaattatgggttctaggttgggctgctttcccagacacccttgctagggatggtttgcgttacgactccgcttctgacaacgtgtatatgaatgcagaacaagaagaaaaggctaagaaggctaacaacccacaacacagtataacaaaggatgaaattaagcaatacgtcaaagaatacgtccaagctgccaaaaactccattgctgctggtgccgatggtgttgaaatccacagcgctaacggttacttgttgaaccagttcttggacccacactccaataacagaaccgatgagtatggtggatccatcgaaaacagagcccgtttcaccttggaagtggttgatgcagttgtcgatgctattggccctgaaaaagtcggtttgagattgtctccatatggtgtcttcaacagtatgtctggtggtgctgaaaccggtattgttgctcaatatgcttatgtcttaggtgaactagaaagaagagctaaagctggcaagcgtttggctttcgtccatctagttgaacctcgtgtcaccaacccatttttaactgaaggtgaaggtgaatacaatggaggtagcaacaaatttgcttattctatctggaagggcccaattattagagctggtaactttgctctgcacccagaagttgtcagagaagaggtgaaggatcctagaacattgatcggttacggtagattttttatctctaatccagatttggttgatcgtttggaaaaagggttaccattaaacaaatatgacagagacactttctacaaaatgtcagctgagggatacattgactaccctacgtacgaagaagctctaaaactcggttgggacaaaaattaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]