2025-07-15 21:38:29, GGRNA.v2 : RefSeq release 229 (Mar, 2025)
LOCUS NM_001179179 732 bp mRNA linear PLN 17-DEC-2024 DEFINITION Saccharomyces cerevisiae S288C putative serine hydrolase (FSH1), partial mRNA. ACCESSION NM_001179179 VERSION NM_001179179.1 DBLINK BioProject: PRJNA128 KEYWORDS RefSeq. SOURCE Saccharomyces cerevisiae S288C ORGANISM Saccharomyces cerevisiae S288C Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces. REFERENCE 1 (bases 1 to 732) AUTHORS Engel,S.R., Wong,E.D., Nash,R.S., Aleksander,S., Alexander,M., Douglass,E., Karra,K., Miyasato,S.R., Simison,M., Skrzypek,M.S., Weng,S. and Cherry,J.M. TITLE New data and collaborations at the Saccharomyces Genome Database: updated reference genome, alleles, and the Alliance of Genome Resources JOURNAL Genetics 220 (4) (2022) PUBMED 34897464 REFERENCE 2 (bases 1 to 732) AUTHORS Goffeau,A., Barrell,B.G., Bussey,H., Davis,R.W., Dujon,B., Feldmann,H., Galibert,F., Hoheisel,J.D., Jacq,C., Johnston,M., Louis,E.J., Mewes,H.W., Murakami,Y., Philippsen,P., Tettelin,H. and Oliver,S.G. TITLE Life with 6000 genes JOURNAL Science 274 (5287), 546 (1996) PUBMED 8849441 REFERENCE 3 (bases 1 to 732) AUTHORS Johnston,M., Andrews,S., Brinkman,R., Cooper,J., Ding,H., Dover,J., Du,Z., Favello,A., Fulton,L., Gattung,S. et al. TITLE Complete nucleotide sequence of Saccharomyces cerevisiae chromosome VIII JOURNAL Science 265 (5181), 2077-2082 (1994) PUBMED 8091229 REFERENCE 4 (bases 1 to 732) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (17-DEC-2024) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 5 (bases 1 to 732) CONSRTM Saccharomyces Genome Database TITLE Direct Submission JOURNAL Submitted (04-MAY-2012) Department of Genetics, Stanford University, Stanford, CA 94305-5120, USA REMARK Protein update by submitter REFERENCE 6 (bases 1 to 732) CONSRTM Saccharomyces Genome Database TITLE Direct Submission JOURNAL Submitted (31-MAR-2011) Department of Genetics, Stanford University, Stanford, CA 94305-5120, USA REMARK Sequence update by submitter REFERENCE 7 (bases 1 to 732) CONSRTM Saccharomyces Genome Database TITLE Direct Submission JOURNAL Submitted (11-DEC-2009) Department of Genetics, Stanford University, Stanford, CA 94305-5120, USA COMMENT REVIEWED REFSEQ: This record has been curated by SGD. This record is derived from an annotated genomic sequence (NC_001140). ##Genome-Annotation-Data-START## Annotation Provider :: SGD Annotation Status :: Full Annotation Annotation Version :: R64-4-1 URL :: http://www.yeastgenome.org/ ##Genome-Annotation-Data-END## COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..732 /organism="Saccharomyces cerevisiae S288C" /mol_type="mRNA" /strain="S288C" /db_xref="taxon:559292" /chromosome="VIII" gene <1..>732 /gene="FSH1" /locus_tag="YHR049W" /db_xref="GeneID:856445" CDS 1..732 /gene="FSH1" /locus_tag="YHR049W" /experiment="EXISTENCE:direct assay:GO:0004622 lysophospholipase activity [PMID:32920715]" /experiment="EXISTENCE:direct assay:GO:0005634 nucleus [PMID:14562095]" /experiment="EXISTENCE:direct assay:GO:0005737 cytoplasm [PMID:14562095]" /experiment="EXISTENCE:direct assay:GO:0016788 hydrolase activity, acting on ester bonds [PMID:32182256]" /experiment="EXISTENCE:mutant phenotype:GO:0006915 apoptotic process [PMID:31363875]" /note="Lysophospholipase; hydrolyzes lysophosphatidylserine to release free fatty acid; involved in regulated cell death; localizes to both the nucleus and cytoplasm; contains a catalytic triad of Ser-His-Asp that is part of an alpha/beta hydrolase fold and a lipase motif (GXSXG); sequence similarity to Fsh2p and Fsh3p and the human candidate tumor suppressor and serine hydrolase, OVCA2" /codon_start=1 /product="putative serine hydrolase" /protein_id="NP_011915.1" /db_xref="GeneID:856445" /db_xref="SGD:S000001091" /translation="
MTVQIPKLLFLHGFLQNGKVFSEKSSGIRKLLKKANVQCDYIDAPVLLEKKDLPFEMDDEKWQATLDADVNRAWFYHSEISHELDISEGLKSVVDHIKANGPYDGIVGFSQGAALSSIITNKISELVPDHPQFKVSVVISGYSFTEPDPEHPGELRITEKFRDSFAVKPDMKTKMIFIYGASDQAVPSVRSKYLYDIYLKAQNGNKEKVLAYEHPGGHMVPNKKDIIRPIVEQITSSLQEASE"
misc_feature 16..687 /gene="FSH1" /locus_tag="YHR049W" /note="Serine hydrolase (FSH1); Region: FSH1; pfam03959" /db_xref="CDD:461110" ORIGIN
atgactgtacaaattccaaaattattatttttacacggcttcttgcaaaacggtaaagttttctccgaaaaatcatctggtattagaaaattattgaagaaggctaatgtccaatgtgactatattgatgcaccagtccttttagaaaagaaggacttgccatttgaaatggatgatgaaaaatggcaagccaccctagatgcggatgttaacagagcctggttctatcacagcgaaatctctcacgaattggatatctcagaaggtttgaagtctgttgttgatcacatcaaggccaatggcccatacgacggcattgtcggtttctctcaaggtgccgcattgtcctctatcatcaccaacaagatctcagagttagttccagaccatccacaattcaaggtaagtgtagtcatttccggctattccttcaccgagccagacccagaacatcctggagaattgagaataaccgaaaaattcagagactcatttgcggtaaaaccagacatgaagaccaagatgatcttcatctatggtgcttctgaccaagccgtcccatccgtcagatccaagtacctgtacgatatttatttgaaggcgcaaaatggtaataaggaaaaggtgttggcttacgaacaccctggtggacatatggttccaaacaagaaggacattatcagaccaattgttgaacaaataacctcttccttacaagaagcttctgaataa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]