GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-08-20 22:58:08, GGRNA.v2 : RefSeq release 230 (May, 2025)

LOCUS       NM_001178225             705 bp    mRNA    linear   PLN 05-MAR-2025
DEFINITION  Saccharomyces cerevisiae S288C DUP240 family protein MST28 (MST28),
            partial mRNA.
ACCESSION   NM_001178225
VERSION     NM_001178225.1
DBLINK      BioProject: PRJNA128
KEYWORDS    RefSeq.
SOURCE      Saccharomyces cerevisiae S288C
  ORGANISM  Saccharomyces cerevisiae S288C
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Saccharomycetes; Saccharomycetales; Saccharomycetaceae;
            Saccharomyces.
REFERENCE   1  (bases 1 to 705)
  AUTHORS   Engel,S.R., Wong,E.D., Nash,R.S., Aleksander,S., Alexander,M.,
            Douglass,E., Karra,K., Miyasato,S.R., Simison,M., Skrzypek,M.S.,
            Weng,S. and Cherry,J.M.
  TITLE     New data and collaborations at the Saccharomyces Genome Database:
            updated reference genome, alleles, and the Alliance of Genome
            Resources
  JOURNAL   Genetics 220 (4) (2022)
   PUBMED   34897464
REFERENCE   2  (bases 1 to 705)
  AUTHORS   Goffeau,A., Barrell,B.G., Bussey,H., Davis,R.W., Dujon,B.,
            Feldmann,H., Galibert,F., Hoheisel,J.D., Jacq,C., Johnston,M.,
            Louis,E.J., Mewes,H.W., Murakami,Y., Philippsen,P., Tettelin,H. and
            Oliver,S.G.
  TITLE     Life with 6000 genes
  JOURNAL   Science 274 (5287), 546 (1996)
   PUBMED   8849441
REFERENCE   3  (bases 1 to 705)
  AUTHORS   Bussey,H., Kaback,D.B., Zhong,W., Vo,D.T., Clark,M.W., Fortin,N.,
            Hall,J., Ouellette,B.F., Keng,T., Barton,A.B. et al.
  TITLE     The nucleotide sequence of chromosome I from Saccharomyces
            cerevisiae
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 92 (9), 3809-3813 (1995)
   PUBMED   7731988
REFERENCE   4  (bases 1 to 705)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (05-MAR-2025) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   5  (bases 1 to 705)
  CONSRTM   Saccharomyces Genome Database
  TITLE     Direct Submission
  JOURNAL   Submitted (31-MAR-2011) Department of Genetics, Stanford
            University, Stanford, CA 94305-5120, USA
  REMARK    Sequence update by submitter
REFERENCE   6  (bases 1 to 705)
  CONSRTM   Saccharomyces Genome Database
  TITLE     Direct Submission
  JOURNAL   Submitted (11-DEC-2009) Department of Genetics, Stanford
            University, Stanford, CA 94305-5120, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by SGD. This record
            is derived from an annotated genomic sequence (NC_001133).
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: SGD
            Annotation Status   :: Full Annotation
            Annotation Version  :: R64-5-1
            URL                 :: http://www.yeastgenome.org/
            ##Genome-Annotation-Data-END##
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..705
                     /organism="Saccharomyces cerevisiae S288C"
                     /mol_type="mRNA"
                     /strain="S288C"
                     /db_xref="taxon:559292"
                     /chromosome="I"
     gene            <1..>705
                     /gene="MST28"
                     /locus_tag="YAR033W"
                     /db_xref="GeneID:851284"
     CDS             1..705
                     /gene="MST28"
                     /locus_tag="YAR033W"
                     /experiment="EXISTENCE:direct assay:GO:0005783 endoplasmic
                     reticulum [PMID:26928762|PMID:12925749]"
                     /experiment="EXISTENCE:direct assay:GO:0005794 Golgi
                     apparatus [PMID:12925749]"
                     /experiment="EXISTENCE:direct assay:GO:0016020 membrane
                     [PMID:12925749]"
                     /experiment="EXISTENCE:genetic interaction:GO:0016050
                     vesicle organization [PMID:12925749]"
                     /experiment="EXISTENCE:mutant phenotype:GO:0005783
                     endoplasmic reticulum [PMID:12101299]"
                     /experiment="EXISTENCE:mutant phenotype:GO:0005886 plasma
                     membrane [PMID:12101299]"
                     /experiment="EXISTENCE:physical interaction:GO:0016050
                     vesicle organization [PMID:12925749]"
                     /note="Putative integral membrane protein, involved in
                     vesicle formation; forms complex with Mst27p; member of
                     DUP240 gene family; binds COPI and COPII vesicles; MST28
                     has a paralog, MST27, that arose from a segmental
                     duplication"
                     /codon_start=1
                     /product="DUP240 family protein MST28"
                     /protein_id="NP_009419.1"
                     /db_xref="GeneID:851284"
                     /db_xref="SGD:S000000079"
                     /translation="
MQTPPESTDVKLDTLNEPSAHLIEKNVALPKDIFRSYLSYWIYEIARYTPVMILSLVIGVLVLLIIFFNDNEACVFNSAIFAFTSLVGLLIILSDGNPKLVSRRNFRTELLVDVITRKPAVEGKEWRIITYNMNQYLFNHGQWHTPYYFYSDEDCYRYFLRLVEGVTPKKQTATSIGNSPVTAKPEDAIESASPSSRLNYQNFLLKAAEIERQAQENYWRRRHPNIDALLKKTE"
     misc_feature    223..513
                     /gene="MST28"
                     /locus_tag="YAR033W"
                     /note="DUP family; Region: DUP; pfam00674"
                     /db_xref="CDD:395546"
ORIGIN      
atgcagacccctccagaaagtaccgacgtcaagttagatacacttaacgaacctagtgcacatttaattgagaaaaatgtggctcttcctaaggacatattccgttcgtacttgagttattggatctatgaaatcgctcgctatacaccagtcatgattttgtccctggtaataggggttttggttttattaattatattttttaatgacaacgaagcttgtgttttcaattctgcaatatttgcttttacttctcttgtaggtttgttaataatattaagtgatggtaatccaaagctagtcagtcgtcgaaattttaggaccgagcttttagtggatgtcatcacacgtaaaccggcggtagaagggaaagaatggaggatcatcacatacaacatgaaccaatatttgtttaatcatgggcaatggcatactccgtattacttttacagcgatgaggattgctaccgttattttctacgccttgttgagggagtaacccccaagaagcaaacagccacgtcaattggcaattctccggtcaccgctaagcctgaagatgccatcgagtcagcttctcctagttccagactgaattatcaaaactttttgctcaaggcagcggagatcgaacgacaagctcaggaaaattactggcgaaggcggcatcccaatatcgatgcgcttcttaaaaagacggaatag
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]