GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-04-27 10:46:02, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       NM_001172204             885 bp    mRNA    linear   VRT 21-JUN-2021
DEFINITION  Xenopus laevis ventral anterior homeobox 2 S homeolog (vax2.S),
            mRNA.
ACCESSION   NM_001172204
VERSION     NM_001172204.1
KEYWORDS    RefSeq.
SOURCE      Xenopus laevis (African clawed frog)
  ORGANISM  Xenopus laevis
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Amphibia; Batrachia; Anura; Pipoidea; Pipidae; Xenopodinae;
            Xenopus; Xenopus.
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from AF113517.1.
            
            ##Evidence-Data-START##
            Transcript exon combination :: AF113517.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMN04111048, SAMN04111049
                                           [ECO:0000348]
            ##Evidence-Data-END##
FEATURES             Location/Qualifiers
     source          1..885
                     /organism="Xenopus laevis"
                     /mol_type="mRNA"
                     /db_xref="taxon:8355"
                     /chromosome="1S"
                     /map="1S"
     gene            1..885
                     /gene="vax2.S"
                     /gene_synonym="dres93; vax2-a; vax2-b; vax3; xvax2"
                     /note="ventral anterior homeobox 2 S homeolog"
                     /db_xref="GeneID:100337605"
                     /db_xref="Xenbase:XB-GENE-6464314"
     CDS             1..885
                     /gene="vax2.S"
                     /gene_synonym="dres93; vax2-a; vax2-b; vax3; xvax2"
                     /note="ventral anterior homeobox 3"
                     /codon_start=1
                     /product="ventral anterior homeobox 2b"
                     /protein_id="NP_001165675.1"
                     /db_xref="GeneID:100337605"
                     /db_xref="Xenbase:XB-GENE-6464314"
                     /translation="
MGDGVSEERSPLCGKSATSCSERVRDRGTRADLECSLRGHSLKDIPVTSTSSPGSSKEEVLDSQSPGEADYCRRILVRDAKGTIREIVLPKGLDLDRPKRTRTSFTAEQLYRLELEFQRCQYVVGRERTELARQLNLSETQVKVWFQNRRTKQKKDQSRDSEKRSSSTSESFATCNILRLLEQGRLLSVPAPPNMISSQNNMGTSSGNGTSLGTSGSTSPVISTTPPGAGAFSLQVPSLAASSSPRLPTPFYFPGPLLGGLHEIPSGYGLGSSAFEPYTRLDRKDTASGKKSTS"
     misc_feature    1..81
                     /gene="vax2.S"
                     /gene_synonym="dres93; vax2-a; vax2-b; vax3; xvax2"
                     /note="propagated from UniProtKB/Swiss-Prot (Q9IAX9.1);
                     Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
     misc_feature    127..195
                     /gene="vax2.S"
                     /gene_synonym="dres93; vax2-a; vax2-b; vax3; xvax2"
                     /note="propagated from UniProtKB/Swiss-Prot (Q9IAX9.1);
                     Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
     misc_feature    208..294
                     /gene="vax2.S"
                     /gene_synonym="dres93; vax2-a; vax2-b; vax3; xvax2"
                     /note="Region: vax upstream domain"
     misc_feature    292..474
                     /gene="vax2.S"
                     /gene_synonym="dres93; vax2-a; vax2-b; vax3; xvax2"
                     /note="Region: homeobox"
     misc_feature    order(295..309,313..315,364..366,382..384,421..423,
                     427..432,439..444,448..456,460..465)
                     /gene="vax2.S"
                     /gene_synonym="dres93; vax2-a; vax2-b; vax3; xvax2"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238039"
     misc_feature    301..462
                     /gene="vax2.S"
                     /gene_synonym="dres93; vax2-a; vax2-b; vax3; xvax2"
                     /note="Homeobox domain; Region: Homeobox; pfam00046"
                     /db_xref="CDD:425441"
     misc_feature    order(301..303,310..312,430..432,439..444,451..453)
                     /gene="vax2.S"
                     /gene_synonym="dres93; vax2-a; vax2-b; vax3; xvax2"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:238039"
     misc_feature    529..564
                     /gene="vax2.S"
                     /gene_synonym="dres93; vax2-a; vax2-b; vax3; xvax2"
                     /note="Region: vax downstream domain"
     misc_feature    568..669
                     /gene="vax2.S"
                     /gene_synonym="dres93; vax2-a; vax2-b; vax3; xvax2"
                     /note="propagated from UniProtKB/Swiss-Prot (Q9IAX9.1);
                     Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
     misc_feature    817..840
                     /gene="vax2.S"
                     /gene_synonym="dres93; vax2-a; vax2-b; vax3; xvax2"
                     /note="Region: vax terminal domain"
     exon            1..235
                     /gene="vax2.S"
                     /gene_synonym="dres93; vax2-a; vax2-b; vax3; xvax2"
                     /inference="alignment:Splign:2.1.0"
     exon            236..423
                     /gene="vax2.S"
                     /gene_synonym="dres93; vax2-a; vax2-b; vax3; xvax2"
                     /inference="alignment:Splign:2.1.0"
     exon            424..885
                     /gene="vax2.S"
                     /gene_synonym="dres93; vax2-a; vax2-b; vax3; xvax2"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
atgggcgatggagtgtccgaggagagaagccctctgtgtggcaaatcagccacatcttgttcagaacgagtcagagacaggggaacaagggctgatctggagtgctccttgcgaggccacagtcttaaggacattcctgtgacctccacctccagtcccggctcatccaaggaagaggttctggacagccagtccccaggagaagctgattactgtcgacggatcctggtcagagatgccaaagggacaatcagggagattgttctcccaaagggcctggatcttgatcgacccaaacgtaccagaacatccttcacagctgaacagctttaccgcctggagctggaattccagaggtgccaatatgttgttggcagagagaggacagagctggcaaggcaactcaatctgtcagaaacccaggtcaaagtttggtttcagaacagaagaacgaaacagaaaaaagatcagagtagggactctgagaaacgttcttcttccacttccgaatcctttgctacttgcaatattttgcgattgttggaacaaggcagacttttgtcagtcccagcaccaccgaatatgatctctagtcaaaacaacatgggcacttcatcgggaaatggaaccagcctggggacatcgggaagcacttcaccagtcatcagtactacacctcctggagcaggagctttcagcttacaagttccatcattagcagcctcatcttctccaaggttaccgacccctttttattttcctggtcctctattgggaggtctgcatgaaataccctcagggtatggactgggaagctctgcttttgagccttacactcgcctggataggaaagacactgcttcaggcaagaagtcaacttcttaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]