2024-03-28 22:51:02, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_001169065 282 bp mRNA linear PRI 23-AUG-2020 DEFINITION Papio anubis homeobox A10 (HOXA10), mRNA. ACCESSION NM_001169065 VERSION NM_001169065.1 KEYWORDS RefSeq. SOURCE Papio anubis (olive baboon) ORGANISM Papio anubis Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Cercopithecidae; Cercopithecinae; Papio. COMMENT INFERRED REFSEQ: This record is predicted by genome sequence analysis and is not yet supported by experimental evidence. The reference sequence was derived from DP000507.1. FEATURES Location/Qualifiers source 1..282 /organism="Papio anubis" /mol_type="mRNA" /db_xref="taxon:9555" /chromosome="4" /map="4" gene 1..282 /gene="HOXA10" /note="homeobox A10" /db_xref="GeneID:100137570" CDS 1..282 /gene="HOXA10" /codon_start=1 /product="homeobox protein Hox-A10" /protein_id="NP_001162536.1" /db_xref="GeneID:100137570" /translation="
MPGNSKGENAANWLTAKSGRKKRCPYTKHQTLELEKEFLFNMYLTRERRLEISRSVHLTDRQVKIWFQNRRMKLKKMNRENRIRELTANFNFS"
misc_feature order(58..72,76..78,127..129,145..147,184..186,190..195, 202..207,211..219,223..228) /gene="HOXA10" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 64..225 /gene="HOXA10" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:425441" misc_feature order(64..66,73..75,193..195,202..207,214..216) /gene="HOXA10" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" exon 1..282 /gene="HOXA10" /inference="alignment:Splign:2.1.0" ORIGIN
atgccaggcaattccaaaggtgaaaacgcagccaactggctcacggcaaagagtggtcggaagaagcgctgcccctacacgaagcaccagacactggagctggagaaggagtttctgttcaacatgtaccttactcgtgagcggcgcctagagattagccgcagcgtccacctcacggacagacaagtgaaaatctggtttcagaaccgcaggatgaaactgaagaaaatgaatcgagaaaaccggattcgggagctcacagccaattttaatttttcctga
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]