LOCUS       NM_001162570             848 bp    mRNA    linear   VRT 22-DEC-2022
DEFINITION  Xenopus laevis HESX homeobox 1 L homeolog (hesx1.L), mRNA.
ACCESSION   NM_001162570
VERSION     NM_001162570.1
KEYWORDS    RefSeq.
SOURCE      Xenopus laevis (African clawed frog)
  ORGANISM  Xenopus laevis
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Amphibia; Batrachia; Anura; Pipoidea; Pipidae; Xenopodinae;
            Xenopus; Xenopus.
REFERENCE   1  (bases 1 to 848)
  AUTHORS   Martynova NY, Eroshkin FM, capital O, Cyrillicrlov EE and Zaraisky
            AG.
  TITLE     HMG-box factor SoxD/Sox15 and homeodomain-containing factor
            Xanf1/Hesx1 directly interact and regulate the expression of
            Xanf1/Hesx1 during early forebrain development in Xenopus laevis
  JOURNAL   Gene 638, 52-59 (2018)
   PUBMED   28918251
  REMARK    GeneRIF: Using specific regulatory elements from the Xanf1/Hesx1
            promoter, study show that Xanf1/Hesx1-SoxD/Sox15-heterodimer can
            bind to these elements and stabilizes Xanf1/Hesx1 expression. This
            result explains how Xanf1/Hesx1 can escape inhibition by its own
            protein product and is consistent with the current model which
            proposes that Sox proteins regulate gene expression by forming
            complexes with other transcription factors.
REFERENCE   2  (bases 1 to 848)
  AUTHORS   Martynova,N.Iu., Ermolina,L.V., Eroshkin,F.M., Gioeva,F.K. and
            Zaraiskii,A.G.
  TITLE     [Transcriptional factor Xanf1 interacts with the focal adhesion
            protein zyxin in the early development of the Xenopus laevis brain]
  JOURNAL   Bioorg Khim 34 (4), 573-576 (2008)
   PUBMED   18695732
  REMARK    GeneRIF: binding of the LIM2 domain of zyxin with the Engrailed
            Homology 1 repressor domain of Xanf1 is responsible for the
            interaction of these proteins.
REFERENCE   3  (bases 1 to 848)
  AUTHORS   Martynova NY, Eroshkin FM, Ermolina LV, Ermakova GV, Korotaeva AL,
            Smurova KM, Gyoeva FK and Zaraisky AG.
  TITLE     The LIM-domain protein Zyxin binds the homeodomain factor
            Xanf1/Hesx1 and modulates its activity in the anterior neural plate
            of Xenopus laevis embryo
  JOURNAL   Dev Dyn 237 (3), 736-749 (2008)
   PUBMED   18297730
  REMARK    GeneRIF: These results are consistent with a possible role of Zyxin
            as a negative modulator of Xanf1 transcriptional repressing
            activity.
REFERENCE   4  (bases 1 to 848)
  AUTHORS   Ermakova GV, Solovieva EA, Martynova NY and Zaraisky AG.
  TITLE     The homeodomain factor Xanf represses expression of genes in the
            presumptive rostral forebrain that specify more caudal brain
            regions
  JOURNAL   Dev Biol 307 (2), 483-497 (2007)
   PUBMED   17511981
REFERENCE   5  (bases 1 to 848)
  AUTHORS   Bayramov AV, Martynova NY, Eroshkin FM, Ermakova GV and Zaraisky
            AG.
  TITLE     The homeodomain-containing transcription factor X-nkx-5.1 inhibits
            expression of the homeobox gene Xanf-1 during the Xenopus laevis
            forebrain development
  JOURNAL   Mech Dev 121 (12), 1425-1441 (2004)
   PUBMED   15511636
  REMARK    GeneRIF: X-nkx-5.1 is stage-specific inhibitor of Xanf-1 in the
            anterior neural plate during the Xenopus development
REFERENCE   6  (bases 1 to 848)
  AUTHORS   Ermakova GV, Alexandrova EM, Kazanskaya OV, Vasiliev OL, Smith MW
            and Zaraisky AG.
  TITLE     The homeobox gene, Xanf-1, can control both neural differentiation
            and patterning in the presumptive anterior neurectoderm of the
            Xenopus laevis embryo
  JOURNAL   Development 126 (20), 4513-4523 (1999)
   PUBMED   10498686
REFERENCE   7  (bases 1 to 848)
  AUTHORS   Zaraisky AG, Ecochard V, Kazanskaya OV, Lukyanov SA, Fesenko IV and
            Duprat AM.
  TITLE     The homeobox-containing gene XANF-1 may control development of the
            Spemann organizer
  JOURNAL   Development 121 (11), 3839-3847 (1995)
   PUBMED   8582293
REFERENCE   8  (bases 1 to 848)
  AUTHORS   Zaraisky AG, Lukyanov SA, Vasiliev OL, Smirnov YV, Belyavsky AV and
            Kazanskaya OV.
  TITLE     A novel homeobox gene expressed in the anterior neural plate of the
            Xenopus embryo
  JOURNAL   Dev Biol 152 (2), 373-382 (1992)
   PUBMED   1353734
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from X70282.1.
            
            ##Evidence-Data-START##
            RNAseq introns :: single sample supports all introns SAMN04285340,
                              SAMN04285341 [ECO:0000348]
            ##Evidence-Data-END##
FEATURES             Location/Qualifiers
     source          1..848
                     /organism="Xenopus laevis"
                     /mol_type="mRNA"
                     /db_xref="taxon:8355"
                     /chromosome="4L"
                     /map="4L"
     gene            1..848
                     /gene="hesx1.L"
                     /gene_synonym="anf-1; anf1; anf2; hesx1; hesx1-a; hesx1-b;
                     rpx; Xanf; xanf-1; XANF-2; Xanf2"
                     /note="HESX homeobox 1 L homeolog"
                     /db_xref="GeneID:397950"
                     /db_xref="Xenbase:XB-GENE-864952"
     exon            1..194
                     /gene="hesx1.L"
                     /gene_synonym="anf-1; anf1; anf2; hesx1; hesx1-a; hesx1-b;
                     rpx; Xanf; xanf-1; XANF-2; Xanf2"
                     /inference="alignment:Splign:2.1.0"
     CDS             35..598
                     /gene="hesx1.L"
                     /gene_synonym="anf-1; anf1; anf2; hesx1; hesx1-a; hesx1-b;
                     rpx; Xanf; xanf-1; XANF-2; Xanf2"
                     /note="homeobox expressed in ES cells 1; Homeobox protein
                     ANF-1; xanf1; homeo box-containing protein"
                     /codon_start=1
                     /product="homeobox expressed in ES cells 1-B"
                     /protein_id="NP_001156042.1"
                     /db_xref="GeneID:397950"
                     /db_xref="Xenbase:XB-GENE-864952"
                     /translation="

MSPALQKGSSLMENRSPPSSFSIEHILGLDKKTDVASSPIIKHHRPWIECSSKGVVNGTCWQIPVIACDLPIQVHAVHRSEEEETKIRLEKCFGDEDRLTYKRELSWYRGRRPRTAFTRSQIEILENVFRVNSYPGIDVREELASKLALDEDRIQIWFQNRRAKLKRSHRESQFLIVKDSLSSKIQE"

     misc_feature    order(365..379,383..385,434..436,452..454,491..493,
                     497..502,509..514,518..526,530..535)
                     /gene="hesx1.L"
                     /gene_synonym="anf-1; anf1; anf2; hesx1; hesx1-a; hesx1-b;
                     rpx; Xanf; xanf-1; XANF-2; Xanf2"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238039"
     misc_feature    371..532
                     /gene="hesx1.L"
                     /gene_synonym="anf-1; anf1; anf2; hesx1; hesx1-a; hesx1-b;
                     rpx; Xanf; xanf-1; XANF-2; Xanf2"
                     /note="Homeobox domain; Region: Homeobox; pfam00046"
                     /db_xref="CDD:425441"
     misc_feature    order(371..373,380..382,500..502,509..514,521..523)
                     /gene="hesx1.L"
                     /gene_synonym="anf-1; anf1; anf2; hesx1; hesx1-a; hesx1-b;
                     rpx; Xanf; xanf-1; XANF-2; Xanf2"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:238039"
     exon            195..397
                     /gene="hesx1.L"
                     /gene_synonym="anf-1; anf1; anf2; hesx1; hesx1-a; hesx1-b;
                     rpx; Xanf; xanf-1; XANF-2; Xanf2"
                     /inference="alignment:Splign:2.1.0"
     exon            398..499
                     /gene="hesx1.L"
                     /gene_synonym="anf-1; anf1; anf2; hesx1; hesx1-a; hesx1-b;
                     rpx; Xanf; xanf-1; XANF-2; Xanf2"
                     /inference="alignment:Splign:2.1.0"
     exon            500..848
                     /gene="hesx1.L"
                     /gene_synonym="anf-1; anf1; anf2; hesx1; hesx1-a; hesx1-b;
                     rpx; Xanf; xanf-1; XANF-2; Xanf2"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      

gacaaagtctcagttgagtctcaccagcctcaccatgtctcctgctcttcagaaaggatccagtctgatggaaaacagatctccaccatcttcattttccatcgaacatattttaggattagacaagaagacggatgtggcttcatcacccattattaagcaccaccggccgtggattgagtgtagcagcaagggagtagtcaatggcacctgttggcaaatcccggtgatcgcttgtgatctccccatacaagttcacgccgtgcaccgatccgaggaagaggagactaagatcagactggagaagtgtttcggagatgaggacagactgacctataagagagaactgagctggtatagggggcgccgaccccgaacagctttcactaggagccagattgaaatattggagaatgtgttccgagtgaattcctatccaggtattgatgtcagagaggagctggccagcaaattagctctggatgaggacaggatccagatctggtttcaaaatcgccgtgcaaaactcaaaaggtctcaccgggaatcccagttcctgatagttaaagactcgctatcatcaaagatacaggaatgaggatctccatgtctctttgctgtgatattattatataaaagcaatgggaatatataaagtgaccggtcgctgtttggccagctgcgctcctgatagagccttggacctctgtggttttcactctctattttattctgtgtatttgtctaagatatgtaaatatttgcttgtgtaatataactgtgaaacaatgatgcactttctgtaaatagcctgtttttatcaacaataataaatattttgaactatc

//