GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-04-26 16:56:15, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       NM_001090649            1327 bp    mRNA    linear   VRT 22-MAY-2022
DEFINITION  Xenopus laevis homeobox B7 L homeolog (hoxb7.L), mRNA.
ACCESSION   NM_001090649 NM_001090650
VERSION     NM_001090649.1
KEYWORDS    RefSeq.
SOURCE      Xenopus laevis (African clawed frog)
  ORGANISM  Xenopus laevis
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Amphibia; Batrachia; Anura; Pipoidea; Pipidae; Xenopodinae;
            Xenopus; Xenopus.
REFERENCE   1  (bases 1 to 1327)
  AUTHORS   Klein SL, Strausberg RL, Wagner L, Pontius J, Clifton SW and
            Richardson P.
  TITLE     Genetic and genomic tools for Xenopus research: The NIH Xenopus
            initiative
  JOURNAL   Dev Dyn 225 (4), 384-391 (2002)
   PUBMED   12454917
REFERENCE   2  (bases 1 to 1327)
  AUTHORS   Fritz A and De Robertis EM.
  TITLE     Xenopus homeobox-containing cDNAs expressed in early development
  JOURNAL   Nucleic Acids Res 16 (4), 1453-1469 (1988)
   PUBMED   2894634
REFERENCE   3  (bases 1 to 1327)
  AUTHORS   Wright CV, Cho KW, Fritz A, Burglin TR and De Robertis EM.
  TITLE     A Xenopus laevis gene encodes both homeobox-containing and
            homeobox-less transcripts
  JOURNAL   EMBO J 6 (13), 4083-4094 (1987)
   PUBMED   2894983
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from BC097639.1.
            
            On Jul 25, 2007 this sequence version replaced NM_001090650.1.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BC097639.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMD00012418, SAMD00012419
                                           [ECO:0000348]
            ##Evidence-Data-END##
FEATURES             Location/Qualifiers
     source          1..1327
                     /organism="Xenopus laevis"
                     /mol_type="mRNA"
                     /db_xref="taxon:8355"
                     /chromosome="9_10L"
                     /map="9_10L"
     gene            1..1327
                     /gene="hoxb7.L"
                     /gene_synonym="Hbox2; hbox2-b; hho.c1; hox-2.3; hox2;
                     hox2c; hoxb7; hoxb7-a; hoxb7-b; hoxb7.S; MM3; xeb2;
                     Xhox45; XlHbox2"
                     /note="homeobox B7 L homeolog"
                     /db_xref="GeneID:399312"
                     /db_xref="Xenbase:XB-GENE-6254051"
     exon            1..420
                     /gene="hoxb7.L"
                     /gene_synonym="Hbox2; hbox2-b; hho.c1; hox-2.3; hox2;
                     hox2c; hoxb7; hoxb7-a; hoxb7-b; hoxb7.S; MM3; xeb2;
                     Xhox45; XlHbox2"
                     /inference="alignment:Splign:2.1.0"
     CDS             18..683
                     /gene="hoxb7.L"
                     /gene_synonym="Hbox2; hbox2-b; hho.c1; hox-2.3; hox2;
                     hox2c; hoxb7; hoxb7-a; hoxb7-b; hoxb7.S; MM3; xeb2;
                     Xhox45; XlHbox2"
                     /note="P52; xlHbox-2 B; homeobox B7 S homeolog"
                     /codon_start=1
                     /product="homeobox protein Hox-B7-B"
                     /protein_id="NP_001084118.1"
                     /db_xref="GeneID:399312"
                     /db_xref="Xenbase:XB-GENE-6254051"
                     /translation="
MSSLYYANALFSKYPTATSVFPSGVFSEQTSCAFASSPQRSGYGNSPGGTFPAGSAAHGLFSNGSSLHPQSPAMYPSSYGLDAASFNMHCSPFEQNLSSLMCDPTKQNCTKAEQRDSELHNEANLRIYPWMRSAGSDRKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHTLCLTERQIKIWFQNRRMKWKKENKASSPSSNSQEKPETEEEEEEEEE"
     misc_feature    396..413
                     /gene="hoxb7.L"
                     /gene_synonym="Hbox2; hbox2-b; hho.c1; hox-2.3; hox2;
                     hox2c; hoxb7; hoxb7-a; hoxb7-b; hoxb7.S; MM3; xeb2;
                     Xhox45; XlHbox2"
                     /note="propagated from UniProtKB/Swiss-Prot (P04476.1);
                     Region: Antp-type hexapeptide"
     misc_feature    order(432..446,450..452,501..503,519..521,558..560,
                     564..569,576..581,585..593,597..602)
                     /gene="hoxb7.L"
                     /gene_synonym="Hbox2; hbox2-b; hho.c1; hox-2.3; hox2;
                     hox2c; hoxb7; hoxb7-a; hoxb7-b; hoxb7.S; MM3; xeb2;
                     Xhox45; XlHbox2"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238039"
     misc_feature    order(438..440,447..449,567..569,576..581,588..590)
                     /gene="hoxb7.L"
                     /gene_synonym="Hbox2; hbox2-b; hho.c1; hox-2.3; hox2;
                     hox2c; hoxb7; hoxb7-a; hoxb7-b; hoxb7.S; MM3; xeb2;
                     Xhox45; XlHbox2"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:238039"
     misc_feature    441..599
                     /gene="hoxb7.L"
                     /gene_synonym="Hbox2; hbox2-b; hho.c1; hox-2.3; hox2;
                     hox2c; hoxb7; hoxb7-a; hoxb7-b; hoxb7.S; MM3; xeb2;
                     Xhox45; XlHbox2"
                     /note="Homeobox domain; Region: Homeobox; pfam00046"
                     /db_xref="CDD:425441"
     misc_feature    600..677
                     /gene="hoxb7.L"
                     /gene_synonym="Hbox2; hbox2-b; hho.c1; hox-2.3; hox2;
                     hox2c; hoxb7; hoxb7-a; hoxb7-b; hoxb7.S; MM3; xeb2;
                     Xhox45; XlHbox2"
                     /note="propagated from UniProtKB/Swiss-Prot (P04476.1);
                     Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
     exon            421..1313
                     /gene="hoxb7.L"
                     /gene_synonym="Hbox2; hbox2-b; hho.c1; hox-2.3; hox2;
                     hox2c; hoxb7; hoxb7-a; hoxb7-b; hoxb7.S; MM3; xeb2;
                     Xhox45; XlHbox2"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
aatcattcggccgaattatgagttcattgtattatgccaatgctttattctccaaatatccgactgcaacttctgttttcccatccggagtcttttcagagcaaacttcatgcgcctttgcctccagtccccagcgcagcggctacgggaacagcccgggcggaacgttcccagcggggtcggcggcgcatggtttattcagcaatgggagcagcctgcacccccagagcccggccatgtacccctccagctatgggctcgacgctgcctccttcaatatgcactgctcgccctttgagcagaacctctcctccctcatgtgcgaccccactaagcagaactgcaccaaggctgaacagagggactcggagctgcacaatgaggctaacttgagaatctacccctggatgaggagcgcagggtcggacaggaagaggggtcgccagacctacacaaggtaccagaccctggagctggagaaggagtttcactttaatcgctacctgacccggcggagacgcatagaaatcgctcacactctgtgtctgaccgagagacaaatcaaaatctggttccagaaccgcaggatgaaatggaaaaaggaaaacaaagcgtccagcccttcctctaacagccaagaaaagccggagactgaggaggaggaggaggaggaggaggaatgaagtggccccaatggactagtgagcacgagatgatccactgacccatactacctacatcccttttctactagagggttagctacctacctacctacccacctaactacctacctacctacccacctacttacctacctaccttcccacctaactacctacttacctaactacctacctactcacccaccaacctacccacctgtcccctctgtacaaccactttctatgtggcatctcatttacccaattattccacaagcgtcgcagcattttcatttgttctaccttttttttgaagaatccttgtccctgagagatcgtggtctttaaaaaaaattccttgtgactgtgtttgactagttcgtgcgatataatcgggagaccagtgtgtaggattgtgttaccccccaattcctctttcacaatagactcagtccagtaattggggaaatctcctttcctcctcttccctattgacagatatatgtgtgtaatattttctgtgccatttgaaaaatgtgatgtacaatttaattttaatataatttaatcatagactcctgtgcttctatttcttgatgagttgttgtaatgtttccttcaaataaaatgtaaaaaataaaaatagtaaaaaaaaaaaaaaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]