2024-04-25 10:23:34, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_001085813 990 bp mRNA linear VRT 22-MAY-2022 DEFINITION Xenopus laevis NK3 homeobox 2 S homeolog (nkx3-2.S), mRNA. ACCESSION NM_001085813 VERSION NM_001085813.1 KEYWORDS RefSeq. SOURCE Xenopus laevis (African clawed frog) ORGANISM Xenopus laevis Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Amphibia; Batrachia; Anura; Pipoidea; Pipidae; Xenopodinae; Xenopus; Xenopus. REFERENCE 1 (bases 1 to 990) AUTHORS Tseng HT, Shah R and Jamrich M. TITLE Function and regulation of FoxF1 during Xenopus gut development JOURNAL Development 131 (15), 3637-3647 (2004) PUBMED 15229177 REFERENCE 2 (bases 1 to 990) AUTHORS Newman CS, Grow MW, Cleaver O, Chia F and Krieg P. TITLE Xbap, a vertebrate gene related to bagpipe, is expressed in developing craniofacial structures and in anterior gut muscle JOURNAL Dev Biol 181 (2), 223-233 (1997) PUBMED 9013932 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from U75487.1. ##Evidence-Data-START## Transcript exon combination :: U75487.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMD00012418, SAMD00012419 [ECO:0000348] ##Evidence-Data-END## FEATURES Location/Qualifiers source 1..990 /organism="Xenopus laevis" /mol_type="mRNA" /db_xref="taxon:8355" /chromosome="1S" /map="1S" gene 1..990 /gene="nkx3-2.S" /gene_synonym="bap; bapx1; bapx1-A; nkx3-2; nkx3.2; Xbap" /note="NK3 homeobox 2 S homeolog" /db_xref="GeneID:378569" /db_xref="Xenbase:XB-GENE-876836" CDS 1..990 /gene="nkx3-2.S" /gene_synonym="bap; bapx1; bapx1-A; nkx3-2; nkx3.2; Xbap" /note="bagpipe homeobox protein homolog 1; bagpipe homeobox homolog 1" /codon_start=1 /product="homeobox protein Nkx-3.2" /protein_id="NP_001079282.1" /db_xref="GeneID:378569" /db_xref="Xenbase:XB-GENE-876836" /translation="
MFRGPLDTPWAADVSPSGPRGIKAGRSALLVPILGSIWGAWRPEPGATRYRTLDPMAAVRSSSRLTPFSIQAILNRKEERAHTFPRLATAVSPACCWRIFGESEAEGLGSPCGGAPGAGAGGEPSGWDSDSALSEEGELGRPGDIGERKKQRPLEARAKGEDEEETPGCSDCEIGASVPDPSPPDEDPKCEQLMLEPPKQRKKRSRAAFSHAQVFELERRFNHQRYLSGPERADLAASLKLTETQVKIWFQNRRYKTKRRQMATDLLAAAPAAKKVAVKVLVRDDQRQYHPGEVLHPSLLPLQAPYFYPYYCALPGWTLSAAACSRGTP"
misc_feature 319..564 /gene="nkx3-2.S" /gene_synonym="bap; bapx1; bapx1-A; nkx3-2; nkx3.2; Xbap" /note="propagated from UniProtKB/Swiss-Prot (P70061.1); Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite" misc_feature order(607..621,625..627,676..678,694..696,733..735, 739..744,751..756,760..768,772..777) /gene="nkx3-2.S" /gene_synonym="bap; bapx1; bapx1-A; nkx3-2; nkx3.2; Xbap" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 613..777 /gene="nkx3-2.S" /gene_synonym="bap; bapx1; bapx1-A; nkx3-2; nkx3.2; Xbap" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:395001" misc_feature order(613..615,622..624,742..744,751..756,763..765) /gene="nkx3-2.S" /gene_synonym="bap; bapx1; bapx1-A; nkx3-2; nkx3.2; Xbap" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" exon 1..538 /gene="nkx3-2.S" /gene_synonym="bap; bapx1; bapx1-A; nkx3-2; nkx3.2; Xbap" /inference="alignment:Splign:2.1.0" exon 539..990 /gene="nkx3-2.S" /gene_synonym="bap; bapx1; bapx1-A; nkx3-2; nkx3.2; Xbap" /inference="alignment:Splign:2.1.0" ORIGIN
atgttcagaggccctctggataccccctgggcagcagatgtttcccccagtggcccacgcgggatcaaggctggacgctctgccctgctagtgcccatcttgggatccatttggggagcttggcgcccagagccaggagccacccggtaccggacactggatccaatggcagctgtgcgaagttccagcaggctgactccattctctatccaggctattctgaacaggaaagaggagcgtgcccacacgttccccaggctggccactgcagtctcacccgcctgttgctggaggatctttggggagagtgaagcagaaggactgggctccccatgtggaggggcccctggggcaggagccgggggagagccatccgggtgggactcggattcagccctcagtgaggagggagaactgggaaggccgggggatatcggggagaggaagaagcagaggccgctggaggccagagccaagggggaggatgaggaggaaaccccaggctgcagcgactgcgagataggagccagtgtcccagatcccagccctccagatgaggatcccaagtgtgagcagctgatgctagagccccccaagcagagaaagaagcgctcccgggctgcattctcccatgcccaggtctttgagctggagagacgcttcaaccaccagcgatacttgtctggccctgagcgagctgacctggctgcctcccttaaactaacagagacccaggtgaagatatggttccagaacaggcgctacaagaccaagcgcaggcagatggctaccgaccttcttgctgcagcccctgcagcaaagaaagttgctgtgaaagtgctggtgagggacgatcagagacagtaccatcctggggaggtccttcacccttcactgcttccccttcaggccccttatttctacccttattattgtgccctgcctggctggacgctctccgcagctgcctgcagtagggggacgccataa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]