GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-04-17 06:44:19, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       NM_001085685             742 bp    mRNA    linear   VRT 19-JUN-2021
DEFINITION  Xenopus laevis NK3 homeobox 2 S homeolog (nkx3-3.S), mRNA.
ACCESSION   NM_001085685
VERSION     NM_001085685.1
KEYWORDS    RefSeq.
SOURCE      Xenopus laevis (African clawed frog)
  ORGANISM  Xenopus laevis
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Amphibia; Batrachia; Anura; Pipoidea; Pipidae; Xenopodinae;
            Xenopus; Xenopus.
REFERENCE   1  (bases 1 to 742)
  AUTHORS   Newman CS and Krieg PA.
  TITLE     The Xenopus bagpipe-related homeobox gene zampogna is expressed in
            the pharyngeal endoderm and the visceral musculature of the midgut
  JOURNAL   Dev Genes Evol 209 (2), 132-134 (1999)
   PUBMED   10022957
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from AF095721.1.
            
            ##Evidence-Data-START##
            Transcript exon combination :: AF095721.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMD00012420, SAMN04111061
                                           [ECO:0000348]
            ##Evidence-Data-END##
FEATURES             Location/Qualifiers
     source          1..742
                     /organism="Xenopus laevis"
                     /mol_type="mRNA"
                     /db_xref="taxon:8355"
                     /chromosome="7S"
                     /map="7S"
     gene            1..742
                     /gene="nkx3-3.S"
                     /gene_synonym="bapx; nkx3-3; nkx3-3.L; zampogna; zax;
                     zax-A"
                     /note="NK3 homeobox 2 S homeolog"
                     /db_xref="GeneID:373704"
                     /db_xref="Xenbase:XB-GENE-865322"
     CDS             68..742
                     /gene="nkx3-3.S"
                     /gene_synonym="bapx; nkx3-3; nkx3-3.L; zampogna; zax;
                     zax-A"
                     /note="homeodomain protein zampogna; xzax; bagpipe
                     homeobox; NK3 homeobox 2 L homeolog"
                     /codon_start=1
                     /product="homeobox protein zampogna"
                     /protein_id="NP_001079154.1"
                     /db_xref="GeneID:373704"
                     /db_xref="Xenbase:XB-GENE-865322"
                     /translation="
MSLTSFSIQDILARTGGNRGKDTRTDGNNISPPPSPSADEGHNEWPRAENPPLTPEKEKTDTDSGTEDFHWERDTETANNGAFTDPSSGDRLADSPKSSKKRSRAAFSHAQVYELERRFSLQRYLSGPERADLAASLKLTETQVKIWFQNRRYKTKRKLIATQTAPKSSLVPTRKVAVRVLVKDDQRQYCPEDMLSPSLLSLYHAYQYYPYMYCLPAWVPHLPL"
     misc_feature    68..388
                     /gene="nkx3-3.S"
                     /gene_synonym="bapx; nkx3-3; nkx3-3.L; zampogna; zax;
                     zax-A"
                     /note="propagated from UniProtKB/Swiss-Prot (O93590.1);
                     Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
     misc_feature    206..>541
                     /gene="nkx3-3.S"
                     /gene_synonym="bapx; nkx3-3; nkx3-3.L; zampogna; zax;
                     zax-A"
                     /note="Homeodomain-containing transcription factor
                     [Transcription]; Region: COG5576"
                     /db_xref="CDD:227863"
     misc_feature    order(368..382,386..388,437..439,455..457,494..496,
                     500..505,512..517,521..529,533..538)
                     /gene="nkx3-3.S"
                     /gene_synonym="bapx; nkx3-3; nkx3-3.L; zampogna; zax;
                     zax-A"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238039"
     misc_feature    374..535
                     /gene="nkx3-3.S"
                     /gene_synonym="bapx; nkx3-3; nkx3-3.L; zampogna; zax;
                     zax-A"
                     /note="Homeobox domain; Region: Homeobox; pfam00046"
                     /db_xref="CDD:425441"
     misc_feature    order(374..376,383..385,503..505,512..517,524..526)
                     /gene="nkx3-3.S"
                     /gene_synonym="bapx; nkx3-3; nkx3-3.L; zampogna; zax;
                     zax-A"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:238039"
ORIGIN      
ggcacgagcgcagcctttctcccggccattggatacttctcccggccattggatactatgcactaacatgtccctcacctccttctccattcaagatatccttgcgcggaccggaggcaataggggcaaagacacnagaactgatgggaataatatctctccgccgccctctcccagcgctgatgaggggcacaatgaatggccgcgggcggagaacccgccactgactccggagaaagagaaaacggacacagactcagggacagaggacttccactgggagcgggacacagaaacagccaacaatggtgcttttacagatccttcttctggggacagactggcagacagccccaagtccagtaagaagaggtctcgggctgctttttctcatgctcaggtttatgaactggagaggaggttcagcctgcagcggtacctctctgggcctgaaagggcagacctggcagcttctctcaaactcacagagacccaagtaaagatttggtttcagaaccggcggtacaagaccaagaggaagctgattgccacccagacagcaccaaagtcctctcttgttccaaccagaaaggtggcagtcagggtgctggtaaaggatgaccagagacaatattgccctgaggatatgctgagcccatcccttctctctttataccatgcataccagtattatccatacatgtactgtctgccagcctgggtaccccaccttccactttga
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]