GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-04-19 22:44:18, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       NM_001081569             768 bp    mRNA    linear   PRI 20-JUN-2021
DEFINITION  Pan troglodytes homeobox D4 (HOXD4), mRNA.
ACCESSION   NM_001081569 XM_001153123
VERSION     NM_001081569.1
KEYWORDS    RefSeq.
SOURCE      Pan troglodytes (chimpanzee)
  ORGANISM  Pan troglodytes
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Pan.
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from DQ977326.1.
            
            On Feb 17, 2007 this sequence version replaced XM_001153123.1.
            
            ##Evidence-Data-START##
            RNAseq introns :: single sample supports all introns SAMN01120800,
                              SAMN01120804 [ECO:0000348]
            ##Evidence-Data-END##
FEATURES             Location/Qualifiers
     source          1..768
                     /organism="Pan troglodytes"
                     /mol_type="mRNA"
                     /db_xref="taxon:9598"
                     /chromosome="2B"
                     /map="2B"
     gene            1..768
                     /gene="HOXD4"
                     /note="homeobox D4"
                     /db_xref="GeneID:739805"
                     /db_xref="VGNC:VGNC:1966"
     CDS             1..768
                     /gene="HOXD4"
                     /note="homeo box D4"
                     /codon_start=1
                     /product="homeobox protein Hox-D4"
                     /protein_id="NP_001075038.1"
                     /db_xref="GeneID:739805"
                     /db_xref="VGNC:VGNC:1966"
                     /translation="
MVMSSYMVNSKYVDPKFPPCEEYLQGGYLGEQGADYYGGGAQGADFQPPGLYPRPDFGEQPFGGSGPGPGSALPARGHGQEPGGPGGHYAAPGEPCPAPPAPPPAPLPGARACSQSDPKQPPPGTALKQPAVVYPWMKKVHVNSVNPNYTGGEPKRSRTAYTRQQVLELEKEFHFNRYLTRRRRIEIAHTLCLSERQIKIWFQNRRMKWKKDHKLPNTKGRSSSSSSSSSCSSSVAPSQHLQPMAKDHHTDLTTL"
     misc_feature    91..384
                     /gene="HOXD4"
                     /note="propagated from UniProtKB/Swiss-Prot (A2T6X6.1);
                     Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
     misc_feature    397..414
                     /gene="HOXD4"
                     /note="propagated from UniProtKB/Swiss-Prot (A2T6X6.1);
                     Region: Antp-type hexapeptide"
     misc_feature    order(463..477,481..483,532..534,550..552,589..591,
                     595..600,607..612,616..624,628..633)
                     /gene="HOXD4"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238039"
     misc_feature    469..630
                     /gene="HOXD4"
                     /note="Homeobox domain; Region: Homeobox; pfam00046"
                     /db_xref="CDD:425441"
     misc_feature    order(469..471,478..480,598..600,607..612,619..621)
                     /gene="HOXD4"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:238039"
     misc_feature    634..765
                     /gene="HOXD4"
                     /note="propagated from UniProtKB/Swiss-Prot (A2T6X6.1);
                     Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
     exon            1..433
                     /gene="HOXD4"
                     /inference="alignment:Splign:2.1.0"
     exon            434..768
                     /gene="HOXD4"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
atggtcatgagttcgtatatggtgaactccaagtatgtggaccccaagttccctccgtgcgaggagtatttgcagggcggctacctaggcgagcagggcgccgactactacggcggcggcgcgcagggcgcagacttccagcccccggggctctacccacggcccgacttcggtgagcagcctttcggaggcagcggccccgggcctggctcggcgctgcctgcgcggggtcacggacaagagccaggcggccccggcggtcactacgccgctccaggagagccttgcccagctcccccggcgcctccgccggcgcccctgcctggcgcccgggcctgcagtcagtccgaccccaagcagccgccccccgggacggcactcaagcagccggccgtggtctacccctggatgaagaaggtgcacgtgaattcggtgaaccccaactacaccggtggggaacccaagcggtcccgaacggcctacacccggcagcaagtcctagaactggaaaaagaatttcattttaacaggtatctgacaaggcgccgtcggattgaaatcgctcacaccctgtgtctgtcggagcgccagatcaagatctggttccagaaccggaggatgaagtggaaaaaagatcataagctgcccaacactaaaggcaggtcatcgtcctcatcttcctcctcatcttgctcctcctcagtcgcccccagccagcatttacagccgatggccaaagaccaccacacggacctgacgaccttatag
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]