2024-04-25 05:30:44, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_001081487 555 bp mRNA linear PRI 20-JUN-2021 DEFINITION Pan troglodytes retina and anterior neural fold homeobox 2 (RAX2), mRNA. ACCESSION NM_001081487 XM_001136381 XM_524055 VERSION NM_001081487.1 KEYWORDS RefSeq. SOURCE Pan troglodytes (chimpanzee) ORGANISM Pan troglodytes Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Pan. COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from DQ977350.1. On or before Feb 10, 2007 this sequence version replaced XM_524055.2, XM_001136381.1. ##Evidence-Data-START## RNAseq introns :: single sample supports all introns SAMN02045701, SAMN02189948 [ECO:0000348] ##Evidence-Data-END## FEATURES Location/Qualifiers source 1..555 /organism="Pan troglodytes" /mol_type="mRNA" /db_xref="taxon:9598" /chromosome="19" /map="19" gene 1..555 /gene="RAX2" /gene_synonym="RAXL1" /note="retina and anterior neural fold homeobox 2" /db_xref="GeneID:468668" /db_xref="VGNC:VGNC:2273" CDS 1..555 /gene="RAX2" /gene_synonym="RAXL1" /note="retina and anterior neural fold homeobox like 1; retina and anterior neural fold homeobox-like protein 1" /codon_start=1 /product="retina and anterior neural fold homeobox protein 2" /protein_id="NP_001074956.1" /db_xref="GeneID:468668" /db_xref="VGNC:VGNC:2273" /translation="
MFLSPGEGPATEGGGLGPGEEAPKKKHRRNRTTFTTYQLHQLERAFEASHYPDVYSREELAAKVHLPEVRVQVWFQNRRAKWRRQERLESGSGAVAAPRLPEAPALPFARPPAMSLPLEPWLGPGPPAVPGLPRLLGPGPGLQASFGPHAFAPTFADGFALEEASLRLLAKEHAQAMDRAWPPA"
misc_feature 1..99 /gene="RAX2" /gene_synonym="RAXL1" /note="propagated from UniProtKB/Swiss-Prot (A2T711.1); Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite" misc_feature order(82..96,100..102,151..153,169..171,208..210,214..219, 226..231,235..243,247..252) /gene="RAX2" /gene_synonym="RAXL1" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature order(88..90,97..99,217..219,226..231,238..240) /gene="RAX2" /gene_synonym="RAXL1" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 91..249 /gene="RAX2" /gene_synonym="RAXL1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:425441" exon 1..216 /gene="RAX2" /gene_synonym="RAXL1" /inference="alignment:Splign:2.1.0" exon 217..555 /gene="RAX2" /gene_synonym="RAXL1" /inference="alignment:Splign:2.1.0" ORIGIN
atgttcctgagcccgggcgaggggccggcaaccgagggtgggggtctggggccgggcgaggaggcccccaagaagaagcaccggaggaaccgcaccaccttcaccacctaccagctgcaccagctggagcgggcgttcgaggcctctcactacccggatgtgtacagccgtgaggagctggcagccaaggtgcacctacctgaggtgcgcgtgcaggtgtggttccagaaccgccgggccaagtggcgccgccaggagcggctggagtcaggctcgggtgccgtggcagctccgagactccccgaggccccagcgctgccgttcgcccgccccccggccatgtcgctgcccctggagccctggttgggccctggaccgccggccgtgccaggcctcccccgcctcctgggcccgggcccggggctgcaagcgtccttcgggcctcatgcctttgctcccaccttcgcagatggcttcgccctggaggaggcgtccctgcggctgctggccaaggaacacgcacaggctatggacagggcctggccgccagcctga
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]