GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-04-19 09:37:10, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       NM_001040416            1574 bp    mRNA    linear   PRI 18-NOV-2023
DEFINITION  Macaca mulatta msh homeobox 1 (MSX1), mRNA.
ACCESSION   NM_001040416
VERSION     NM_001040416.2
KEYWORDS    RefSeq.
SOURCE      Macaca mulatta (Rhesus monkey)
  ORGANISM  Macaca mulatta
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
REFERENCE   1  (bases 1 to 1574)
  AUTHORS   Perry GH, Verrelli BC and Stone AC.
  TITLE     Molecular evolution of the primate developmental genes MSX1 and
            PAX9
  JOURNAL   Mol Biol Evol 23 (3), 644-654 (2006)
   PUBMED   16326750
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            QNVO02000366.1.
            
            On Oct 23, 2019 this sequence version replaced NM_001040416.1.
            
            Sequence Note: The RefSeq transcript and protein were derived from
            genomic sequence to make the sequence consistent with the reference
            genome assembly. The genomic coordinates used for the transcript
            record were based on alignments.
            
            ##Evidence-Data-START##
            RNAseq introns :: single sample supports all introns SAMEA4688315,
                              SAMEA4688317 [ECO:0000348]
            ##Evidence-Data-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-716               QNVO02000366.1     42483999-42484714
            717-1574            QNVO02000366.1     42487022-42487879
FEATURES             Location/Qualifiers
     source          1..1574
                     /organism="Macaca mulatta"
                     /mol_type="mRNA"
                     /db_xref="taxon:9544"
                     /chromosome="5"
                     /map="5"
     gene            1..1574
                     /gene="MSX1"
                     /note="msh homeobox 1"
                     /db_xref="GeneID:722771"
     exon            1..716
                     /gene="MSX1"
                     /inference="alignment:Splign:2.1.0"
     CDS             248..1159
                     /gene="MSX1"
                     /note="msh homeobox homolog 1; msh homeobox 1-like
                     protein"
                     /codon_start=1
                     /product="homeobox protein MSX-1"
                     /protein_id="NP_001035506.1"
                     /db_xref="GeneID:722771"
                     /translation="
MAPAADMTSLPLGVKVEDSAFGKPAGGGAGQAPSAAAATAAAMGADEEGAKPKVSPSLLPFSVEALMADHRKPGAKESALAPSEGAQAAGGPAQPLGVPPGSLGAPDAPSSPRPLGHFSVGGLLKLPEDALVKAESPEKPERTPWMQSPRFSPPPARRLSPPACTLRKHKTNRKPRTPFTTAQLLALERKFRQKQYLSIAERAEFSSSLSLTETQVKIWFQNRRAKAKRLQEAELEKLKMAAKPMLPPAAFGLSFPLGGPAAVAAAAGASLYGASGPFQRAALPVAPVGLYTAHVGYSMYHLT"
     misc_feature    299..415
                     /gene="MSX1"
                     /note="propagated from UniProtKB/Swiss-Prot (Q2VL87.2);
                     Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
     misc_feature    452..607
                     /gene="MSX1"
                     /note="propagated from UniProtKB/Swiss-Prot (Q2VL87.2);
                     Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
     misc_feature    <458..>991
                     /gene="MSX1"
                     /note="104 kDa microneme/rhoptry antigen; Provisional;
                     Region: PTZ00449"
                     /db_xref="CDD:185628"
     misc_feature    644..736
                     /gene="MSX1"
                     /note="propagated from UniProtKB/Swiss-Prot (Q2VL87.2);
                     Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
     misc_feature    764..1060
                     /gene="MSX1"
                     /note="propagated from UniProtKB/Swiss-Prot (Q2VL87.2);
                     Region: Required for interaction with EHMT2.
                     /evidence=ECO:0000250|UniProtKB:P13297"
     misc_feature    order(764..778,782..784,833..835,851..853,890..892,
                     896..901,908..913,917..925,929..934)
                     /gene="MSX1"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238039"
     misc_feature    770..931
                     /gene="MSX1"
                     /note="Homeobox domain; Region: Homeobox; pfam00046"
                     /db_xref="CDD:425441"
     misc_feature    order(770..772,779..781,899..901,908..913,920..922)
                     /gene="MSX1"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:238039"
     exon            717..1574
                     /gene="MSX1"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
agggccaggaaccggcgggtgctcccgggaactccgcctgtgttgcggcggcggcggcggcgaccaccaggagccaggcccagcgcgccggagctggcctgctggggaggggcgggaggcgcgcgcgggagggtccgccccgccagagccccgggcgctcccagaggcaggcagcgctcccagcctgccccgagcccatgcccggcggctggcccgtgctgcggcaggagggggggcccggctctgcatggccccggctgctgacatgacttctttgccactcggtgtcaaagtggaggactccgctttcggcaagccggcggggggaggcgcaggccaggcccccagcgcagccgcggccacggctgccgccatgggcgcggacgaggagggggccaagcccaaagtgtccccttcgctcctgcccttcagcgtggaggctctcatggccgaccacaggaagccgggggccaaggagagcgccctggcgccctccgagggcgcgcaggcggcgggtggcccggcgcagccactgggcgtcccgccggggtcgctgggcgccccggacgcgccctcttcgccgcggccgctcggccatttctcggtggggggactcctgaagctgccagaagatgcgctcgtcaaagccgagagccccgagaagcccgagaggacgccctggatgcagagcccccgcttctccccgccgccggccaggcggctgagccccccagcctgcaccctccgcaaacacaagacgaaccgtaagccgcggacacccttcaccaccgcgcagctgctggcactggagcgcaagttccgccagaagcagtacctgtccatcgccgagcgcgcggaattctccagctcgctcagcctcactgagacgcaggtgaagatatggttccagaaccgccgcgccaaggcaaagagactacaagaggcagagctggagaagctgaagatggccgccaagcccatgctgccaccggctgccttcggcctctccttccctcttggcggccccgcagctgtagcggccgcggcgggtgcctcgctctacggtgcctctggccccttccagcgcgctgcgctgcccgtggcgccagtgggactctacacggcccatgtaggctacagcatgtaccacctgacatagagggtcccacggtcgcccacctgtgggccatccgattcctccagccctggtgctgtacccccgacgtgctccactgctcagcaccaccagctgccttcctttaaacccccacactgctccagtttcagttctttgctccctgagttcagtctccgaagtctgatccctgccgaaaagtgactggaagggtcccttagtacttttctagaatttagatctacactctcaagttaaagatggggaaactgagggcagagcggttaagaatttatccaaggtccccagcagaattggcagttgaacagaactagaggccatgtctcctgcatagcttttccctgtcctgacaccaggcaggaaaagcgcagagaaattgatgtctgacgattttggaaatgagaacaatctcaaaaaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]