LOCUS       NM_001039830             963 bp    mRNA    linear   VRT 17-DEC-2022
DEFINITION  Danio rerio taste receptor, type 2, member 200, tandem duplicate 1
            (tas2r200.1), mRNA.
ACCESSION   NM_001039830
VERSION     NM_001039830.1
KEYWORDS    RefSeq.
SOURCE      Danio rerio (zebrafish)
  ORGANISM  Danio rerio
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Actinopterygii; Neopterygii; Teleostei; Ostariophysi;
            Cypriniformes; Danionidae; Danioninae; Danio.
REFERENCE   1  (bases 1 to 963)
  AUTHORS   Behrens M, Di Pizio A, Redel U, Meyerhof W and Korsching SI.
  TITLE     At the Root of T2R Gene Evolution: Recognition Profiles of
            Coelacanth and Zebrafish Bitter Receptors
  JOURNAL   Genome Biol Evol 13 (1) (2021)
   PUBMED   33355666
REFERENCE   2  (bases 1 to 963)
  AUTHORS   Ohmoto M, Okada S, Nakamura S, Abe K and Matsumoto I.
  TITLE     Mutually exclusive expression of Galphaia and Galpha14 reveals
            diversification of taste receptor cells in zebrafish
  JOURNAL   J Comp Neurol 519 (8), 1616-1629 (2011)
   PUBMED   21452212
REFERENCE   3  (bases 1 to 963)
  AUTHORS   Oike H, Nagai T, Furuyama A, Okada S, Aihara Y, Ishimaru Y, Marui
            T, Matsumoto I, Misaka T and Abe K.
  TITLE     Characterization of ligands for fish taste receptors
  JOURNAL   J Neurosci 27 (21), 5584-5592 (2007)
   PUBMED   17522303
REFERENCE   4  (bases 1 to 963)
  AUTHORS   Go Y.
  CONSRTM   SMBE Tri-National Young Investigators
  TITLE     Proceedings of the SMBE Tri-National Young Investigators' Workshop
            2005. Lineage-specific expansions and contractions of the bitter
            taste receptor gene repertoire in vertebrates
  JOURNAL   Mol Biol Evol 23 (5), 964-972 (2006)
   PUBMED   16484289
REFERENCE   5  (bases 1 to 963)
  AUTHORS   Ishimaru Y, Okada S, Naito H, Nagai T, Yasuoka A, Matsumoto I and
            Abe K.
  TITLE     Two families of candidate taste receptors in fishes
  JOURNAL   Mech Dev 122 (12), 1310-1321 (2005)
   PUBMED   16274966
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from AB200903.1.
            
            ##Evidence-Data-START##
            Transcript exon combination :: AB200903.1 [ECO:0000332]
            ##Evidence-Data-END##
FEATURES             Location/Qualifiers
     source          1..963
                     /organism="Danio rerio"
                     /mol_type="mRNA"
                     /strain="Wako-Riken"
                     /db_xref="taxon:7955"
                     /chromosome="8"
                     /map="8"
     gene            1..963
                     /gene="tas2r200.1"
                     /gene_synonym="tas2r1a"
                     /note="taste receptor, type 2, member 200, tandem
                     duplicate 1"
                     /db_xref="GeneID:664690"
                     /db_xref="ZFIN:ZDB-GENE-070917-4"
     CDS             1..963
                     /gene="tas2r200.1"
                     /gene_synonym="tas2r1a"
                     /note="taste receptor, type 2, member 1a; bitter taste
                     receptor; zfT2R1a; taste receptor, type 2, member 200.1"
                     /codon_start=1
                     /product="taste receptor, type 2, member 200, tandem
                     duplicate 1"
                     /protein_id="NP_001034919.1"
                     /db_xref="GeneID:664690"
                     /db_xref="ZFIN:ZDB-GENE-070917-4"
                     /translation="

MSTDVGNVLFFVGVGVVGVSGNIFNLIFSLQQQVKTRSIQTVGLILDVISISNIILVLSTLAMVVSVFLNAHIWCIKPYPLGLRFEMYLMMTCGFISFWAIAWLSLFYCIKVVNFSSEIFRTLKKNISTVINTAVTLSCLFSFLLFLPAFSLDLPDSADKNISETNITTCPQPTFTLQIDINAYAAAVLLLICPIPLMIMLPTSVRMVVHLCAHTRALQKNQTQVQGSDSYLLVCKLTISLVGVYLSTLFMVALYFIIKVLGAFMTYQALVSAFTFYCGMTSVLLTASNRYLKDKLWSLFCCRKAKEPVSKSQTVVTQDV"

     misc_feature    100..879
                     /gene="tas2r200.1"
                     /gene_synonym="tas2r1a"
                     /note="seven-transmembrane G protein-coupled receptor
                     superfamily; Region: 7tm_GPCRs; cl28897"
                     /db_xref="CDD:452889"
     misc_feature    127..192
                     /gene="tas2r200.1"
                     /gene_synonym="tas2r1a"
                     /note="TM helix 2 [structural motif]; Region: TM helix 2"
                     /db_xref="CDD:410628"
     misc_feature    250..318
                     /gene="tas2r200.1"
                     /gene_synonym="tas2r1a"
                     /note="TM helix 3 [structural motif]; Region: TM helix 3"
                     /db_xref="CDD:410628"
     misc_feature    397..447
                     /gene="tas2r200.1"
                     /gene_synonym="tas2r1a"
                     /note="TM helix 4 [structural motif]; Region: TM helix 4"
                     /db_xref="CDD:410628"
     misc_feature    532..615
                     /gene="tas2r200.1"
                     /gene_synonym="tas2r1a"
                     /note="TM helix 5 [structural motif]; Region: TM helix 5"
                     /db_xref="CDD:410628"
     misc_feature    691..747
                     /gene="tas2r200.1"
                     /gene_synonym="tas2r1a"
                     /note="TM helix 6 [structural motif]; Region: TM helix 6"
                     /db_xref="CDD:410628"
     misc_feature    781..867
                     /gene="tas2r200.1"
                     /gene_synonym="tas2r1a"
                     /note="TM helix 7 [structural motif]; Region: TM helix 7"
                     /db_xref="CDD:410628"
     exon            1..963
                     /gene="tas2r200.1"
                     /gene_synonym="tas2r1a"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      

atgagcaccgacgttgggaacgttctttttttcgttggagttggggttgtcggtgtttctggaaacatattcaaccttatctttagcttacaacagcaagtaaaaaccagatccattcagactgtgggcttaatcctagatgtcatctccatcagcaacatcatcttggtactttccactctcgccatggtggttagtgtgtttctgaatgcccacatttggtgcatcaagccatatcctctcggtctccgttttgaaatgtatctaatgatgacttgcggcttcatcagcttctgggccattgcttggctgagtcttttctactgcatcaaagttgtgaatttctcctctgagatcttcagaacattgaagaagaacatctcaactgtgatcaacactgcggtgacgttgagctgcttgttctccttcttgctattccttccagcgttcagcctcgatcttccagattcagcggataaaaatatcagcgagacaaatatcacaacctgtccacagccgactttcactctacagatagacataaatgcatacgcagccgctgtcctgctcctcatctgcccgatccctctgatgatcatgttgcccacctctgtcagaatggtggtccacctctgcgcccacacacgggcactccagaagaaccagacgcaggtgcagggatccgactcgtatctcttggtgtgcaaactcaccatctctctggtgggagtttatctgtccactctatttatggtggcattgtatttcattataaaggttttgggggcatttatgacatatcaagccctagtcagtgcctttactttttactgtggaatgacttcagtgctactgacggcatcaaacaggtatctgaaagataaactttggagtctgttctgttgcaggaaagcaaaggagccagttagcaaaagtcagacagttgtgacacaggatgtctga

//