GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-05 21:27:13, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       XM_054377956            1700 bp    mRNA    linear   PRI 05-OCT-2023
DEFINITION  PREDICTED: Homo sapiens milk fat globule EGF and factor V/VIII
            domain containing (MFGE8), transcript variant X2, mRNA.
ACCESSION   XM_054377956
VERSION     XM_054377956.1
DBLINK      BioProject: PRJNA807723
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_060939) annotated using gene prediction method: Gnomon,
            supported by EST evidence.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Updated annotation
            Annotation Name             :: GCF_009914755.1-RS_2023_10
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.2
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           RefSeqFE; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 10/02/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1700
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /isolate="CHM13"
                     /db_xref="taxon:9606"
                     /chromosome="15"
                     /sex="female"
                     /cell_line="CHM13htert"
                     /tissue_type="hydatidiform mole"
                     /note="haploid cell line"
     gene            1..1700
                     /gene="MFGE8"
                     /gene_synonym="BA46; EDIL1; HMFG; hP47; HsT19888; MFG-E8;
                     MFGM; OAcGD3S; SED1; SPAG10"
                     /note="milk fat globule EGF and factor V/VIII domain
                     containing; Derived by automated computational analysis
                     using gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 75 ESTs, 478 long SRA reads, and
                     100% coverage of the annotated genomic feature by RNAseq
                     alignments, including 39 samples with support for all
                     annotated introns"
                     /db_xref="GeneID:4240"
                     /db_xref="HGNC:HGNC:7036"
                     /db_xref="MIM:602281"
     CDS             5..988
                     /gene="MFGE8"
                     /gene_synonym="BA46; EDIL1; HMFG; hP47; HsT19888; MFG-E8;
                     MFGM; OAcGD3S; SED1; SPAG10"
                     /codon_start=1
                     /product="lactadherin isoform X2"
                     /protein_id="XP_054233931.1"
                     /db_xref="GeneID:4240"
                     /db_xref="HGNC:HGNC:7036"
                     /db_xref="MIM:602281"
                     /translation="
MWPFPEGGNTIPILHTDICSKNPCHNGGLCEEISQEVRGDVFPSYTCTCLKGYAGNHCETKCVEPLGLENGNIANSQIAASSVRVTFLGLQHWVPELARLNRAGMVNAWTPSSNDDNPWIQVNLLRRMWVTGVVTQGASRLASHEYLKAFKVAYSLNGHEFDFIHDVNKKHKEFVGNWNKNAVHVNLFETPVEAQYVRLYPTSCHTACTLRFELLGCELNGCANPLGLKNNSIPDKQITASSSYKTWGLHLFSWNPSYARLDKQGNFNAWVAGSYGNDQWLQIFPGNWDNHSHKKNLFETPILARYVRILPVAWHNRIALRLELLGC"
     misc_feature    62..181
                     /gene="MFGE8"
                     /gene_synonym="BA46; EDIL1; HMFG; hP47; HsT19888; MFG-E8;
                     MFGM; OAcGD3S; SED1; SPAG10"
                     /note="Calcium-binding EGF-like domain, present in a large
                     number of membrane-bound and extracellular (mostly animal)
                     proteins. Many of these proteins require calcium for their
                     biological function and calcium-binding sites have been
                     found to be located at the...; Region: EGF_CA; cd00054"
                     /db_xref="CDD:238011"
     misc_feature    194..652
                     /gene="MFGE8"
                     /gene_synonym="BA46; EDIL1; HMFG; hP47; HsT19888; MFG-E8;
                     MFGM; OAcGD3S; SED1; SPAG10"
                     /note="Coagulation factor 5/8 C-terminal domain, discoidin
                     domain; Cell surface-attached carbohydrate-binding domain,
                     present in eukaryotes and assumed to have horizontally
                     transferred to eubacterial genomes; Region: FA58C;
                     cd00057"
                     /db_xref="CDD:238014"
     misc_feature    order(332..334,416..418,437..439)
                     /gene="MFGE8"
                     /gene_synonym="BA46; EDIL1; HMFG; hP47; HsT19888; MFG-E8;
                     MFGM; OAcGD3S; SED1; SPAG10"
                     /note="sugar binding site [chemical binding]; other site"
                     /db_xref="CDD:238014"
     misc_feature    665..985
                     /gene="MFGE8"
                     /gene_synonym="BA46; EDIL1; HMFG; hP47; HsT19888; MFG-E8;
                     MFGM; OAcGD3S; SED1; SPAG10"
                     /note="Coagulation factor 5/8 C-terminal domain, discoidin
                     domain; Region: FA58C; smart00231"
                     /db_xref="CDD:214572"
ORIGIN      
ggtgatgtggccttttccagaaggaggaaacaccatacctatcttacacacagatatctgttccaaaaacccctgccacaacggtggtttatgcgaggagatttcccaagaagtgcgaggagatgtcttcccctcgtacacctgcacgtgccttaagggctacgcgggcaaccactgtgagacgaaatgtgtcgagccactgggcctggagaatgggaacattgccaactcacagatcgccgcctcgtctgtgcgtgtgaccttcttgggtttgcagcattgggtcccggagctggcccgcctgaaccgcgcaggcatggtcaatgcctggacacccagcagcaatgacgataacccctggatccaggtgaacctgctgcggaggatgtgggtaacaggtgtggtgacgcagggtgccagccgcttggccagtcatgagtacctgaaggccttcaaggtggcctacagccttaatggacacgaattcgatttcatccatgatgttaataaaaaacacaaggagtttgtgggtaactggaacaaaaacgcggtgcatgtcaacctgtttgagacccctgtggaggctcagtacgtgagattgtaccccacgagctgccacacggcctgcactctgcgctttgagctactgggctgtgagctgaacggatgcgccaatcccctgggcctgaagaataacagcatccctgacaagcagatcacggcctccagcagctacaagacctggggcttgcatctcttcagctggaacccctcctatgcacggctggacaagcagggcaacttcaacgcctgggttgcggggagctacggtaacgatcagtggctgcagatcttccctggcaactgggacaaccactcccacaagaagaacttgtttgagacgcccatcctggctcgctatgtgcgcatcctgcctgtagcctggcacaaccgcatcgccctgcgcctggagctgctgggctgttagtggccacctgccacccccaggtcttcctgctttccatgggcccgctgcctcttggcttctcagcccctttaaatcaccatagggctggggactggggaaggggagggtgttcagaggcagcaccaccacacagtcacccctccctccctctttcccaccctccacctctcacgggccctgccccagcccctaagccccgtcccctaacccccagtcctcactgtcctgttttcttaggcactgagggatctgagtaggtctgggatggacaggaaagggcaaagtagggcgtgtggtttccctgcccctgtccggaccgccgatcccaggtgcgtgtgtctctgtctctcctagcccctctctcacacatcacattcccatggtggcctcaagaaaggcccggaagcgccaggctggagataacagcctcttgcccgtcggccctgcgtcggccctggggtaccatgtggccacaactgctgtggccccctgtccccaagacacttccccttgtctccctggttgcctctcttgccccttgtcctgaagcccagcgacacagaagggggtggggcgggtctatggggagaaagggagcgaggtcagaggagggcatgggttggcagggtgggcgtttggggccctctatgctggcttttcaccccagaggacacaggcagcttccaaaatatatttatcttcttcacgggaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]