2024-05-01 16:46:14, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_047445479 558 bp mRNA linear PRI 05-OCT-2023 DEFINITION PREDICTED: Homo sapiens putative COBW domain-containing protein 7 (LOC124906852), mRNA. ACCESSION XM_047445479 VERSION XM_047445479.1 DBLINK BioProject: PRJNA807723 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_060933) annotated using gene prediction method: Gnomon, supported by EST evidence. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Updated annotation Annotation Name :: GCF_009914755.1-RS_2023_10 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.2 Annotation Method :: Best-placed RefSeq; Gnomon; RefSeqFE; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 10/02/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..558 /organism="Homo sapiens" /mol_type="mRNA" /isolate="CHM13" /db_xref="taxon:9606" /chromosome="9" /sex="female" /cell_line="CHM13htert" /tissue_type="hydatidiform mole" /note="haploid cell line" gene 1..558 /gene="LOC124906852" /note="putative COBW domain-containing protein 7; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 27 ESTs, 48 long SRA reads, 1 Protein, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 36 samples with support for all annotated introns" /db_xref="GeneID:124906852" CDS 188..502 /gene="LOC124906852" /codon_start=1 /product="putative COBW domain-containing protein 7" /protein_id="XP_047301435.1" /db_xref="GeneID:124906852" /translation="
MFIQNLLWEKNMRNKDNHCMEVIRLKGLVSIKDKSQQVIVQGVHELYDLEETPVSWKDDTERTNRLVLIGRNLDKDILKQLFIATVTETEKQWTTHFKEDQVCT"
misc_feature 188..433 /gene="LOC124906852" /note="Cobalamin synthesis protein cobW C-terminal domain; Region: CobW_C; pfam07683" /db_xref="CDD:429593" polyA_site 558 /gene="LOC124906852" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN
tccgagtagctgggattacagagttgatctctctaatgtattagatcttcatgcctttgatagtctctctggaataagtttgcagaaaaaacttcagcatgtgccaggaacacaacctcaccttgatcagagtattgttacaatcacatttgaagtaccaggaaatgcaaaggaagaacatcttaatatgtttattcagaatctcctgtgggaaaagaatatgagaaacaaggacaatcactgcatggaggtcataaggctgaagggattggtgtcaatcaaagacaaatcacaacaagtgattgtccagggtgtccatgagctctatgatctggaggagactccagtgagctggaaggatgacactgagagaacaaatcgattggtcctcattggcagaaatttagataaggatatccttaaacagctgtttatagctactgtgacagaaacagaaaagcagtggacaacacatttcaaagaagatcaagtttgtacataacactagtggcatttcttatcaaaaggattggataataaaaataagtttctactggg
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]