GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-08 02:09:58, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       XM_047443392             950 bp    mRNA    linear   PRI 05-OCT-2023
DEFINITION  PREDICTED: Homo sapiens testis-specific Y-encoded protein 1
            (LOC124909015), transcript variant X1, mRNA.
ACCESSION   XM_047443392
VERSION     XM_047443392.1
DBLINK      BioProject: PRJNA168
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_025791821) annotated using gene prediction method: Gnomon,
            supported by EST evidence.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Updated annotation
            Annotation Name             :: GCF_000001405.40-RS_2023_10
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.2
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           RefSeqFE; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 10/02/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..950
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="Y"
                     /map="Yp11.2"
     gene            1..950
                     /gene="LOC124909015"
                     /note="testis-specific Y-encoded protein 1; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 1 EST, 32 Proteins, and 100% coverage of the annotated
                     genomic feature by RNAseq alignments, including 7 samples
                     with support for all annotated introns"
                     /db_xref="GeneID:124909015"
     variation       9
                     /gene="LOC124909015"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1556183928"
     CDS             18..902
                     /gene="LOC124909015"
                     /codon_start=1
                     /product="testis-specific Y-encoded protein 1 isoform X1"
                     /protein_id="XP_047299348.1"
                     /db_xref="GeneID:124909015"
                     /translation="
MRPEGSLTYRVPERLRQGFCGVGRAAQALVCASAKEGTAFRMEAVQEGAAGVESEQAALGEEAVLLLDDIMAEVEVVAEEEGLVERREEAQRAQQAVPGPGPMTPESALEELLAVQVELEPVNAQARKAFSRQREKMERRRKPQLDRRGAVIQSVPGFWANVIANHPQMSALITDEDEDMLSYMVSLEVEEEKHPVHLCKIMLFFRSNPYFQNKVITKEYLVNITEYRASHSTPIEWYPDYEVEAYRRRHHNSSLNFFNWFSDHNFAGSNKIAESPDRSYVRTCGAIPCNTTRG"
     misc_feature    324..>836
                     /gene="LOC124909015"
                     /note="Nucleosome assembly protein (NAP); Region: NAP;
                     cl08298"
                     /db_xref="CDD:447601"
     variation       44
                     /gene="LOC124909015"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1556183934"
     variation       152
                     /gene="LOC124909015"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1259002950"
     variation       202
                     /gene="LOC124909015"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1603143867"
     variation       205
                     /gene="LOC124909015"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2016060887"
     variation       246
                     /gene="LOC124909015"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2124354815"
     variation       276
                     /gene="LOC124909015"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1348459055"
     variation       280
                     /gene="LOC124909015"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1603143871"
     variation       309
                     /gene="LOC124909015"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2124354826"
     variation       330
                     /gene="LOC124909015"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1603143872"
     variation       343
                     /gene="LOC124909015"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1317472486"
     variation       368
                     /gene="LOC124909015"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1603143877"
     variation       414
                     /gene="LOC124909015"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2124354836"
     variation       449
                     /gene="LOC124909015"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1194474203"
     variation       463
                     /gene="LOC124909015"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:2124354841"
     variation       728
                     /gene="LOC124909015"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1556183981"
     variation       756
                     /gene="LOC124909015"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1556183985"
     variation       928
                     /gene="LOC124909015"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1556183997"
     variation       939
                     /gene="LOC124909015"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1556184001"
ORIGIN      
gcctggaagcccggcgcatgcgccctgagggctcgctgacctaccgggtgccagagaggctgcggcagggtttctgtggcgtgggtcgggcagcacaggccttggtgtgtgcgagtgccaaggagggcaccgccttcaggatggaggctgtacaggagggggcggccggggtggagagtgagcaggcggctttgggggaggaggcggtgctgctgttggatgacataatggcggaggtggaggtggtggcggaggaggagggcctcgtggagcggcgggaggaggcccagcgggcacagcaggctgtgcctggccctgggcccatgaccccagagtctgcactggaggagctgctggccgttcaggtggagctggagccggttaatgcccaagccaggaaggccttttctcggcagcgggaaaagatggagcggaggcgcaagccccagctagaccgcagaggcgccgtcatccagagcgtccctggcttctgggccaatgttattgcaaaccacccccagatgtcagccctgatcactgacgaagatgaagacatgctgagctacatggtcagcctggaggtggaagaagagaagcatcctgttcatctctgcaagatcatgttgttctttcggagtaacccctacttccagaataaagtgattaccaaggaatatctggtgaacatcacagaatacagggcttctcattccactccaattgagtggtatccggattatgaagtggaggcctatcgccgcagacaccacaacagcagccttaacttcttcaactggttctctgaccacaacttcgcaggatctaacaagattgctgagtcccctgacagatcctatgtaaggacctgtggcgcaatcccctgcaatactacaagaggatgaagccacctgaagagggaacagagacgtcaggggactcccagttgttga
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]