2024-05-07 17:30:34, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_047443392 950 bp mRNA linear PRI 05-OCT-2023 DEFINITION PREDICTED: Homo sapiens testis-specific Y-encoded protein 1 (LOC124909015), transcript variant X1, mRNA. ACCESSION XM_047443392 VERSION XM_047443392.1 DBLINK BioProject: PRJNA168 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_025791821) annotated using gene prediction method: Gnomon, supported by EST evidence. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Updated annotation Annotation Name :: GCF_000001405.40-RS_2023_10 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.2 Annotation Method :: Best-placed RefSeq; Gnomon; RefSeqFE; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 10/02/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..950 /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="Y" /map="Yp11.2" gene 1..950 /gene="LOC124909015" /note="testis-specific Y-encoded protein 1; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 EST, 32 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 7 samples with support for all annotated introns" /db_xref="GeneID:124909015" variation 9 /gene="LOC124909015" /replace="c" /replace="g" /db_xref="dbSNP:1556183928" CDS 18..902 /gene="LOC124909015" /codon_start=1 /product="testis-specific Y-encoded protein 1 isoform X1" /protein_id="XP_047299348.1" /db_xref="GeneID:124909015" /translation="
MRPEGSLTYRVPERLRQGFCGVGRAAQALVCASAKEGTAFRMEAVQEGAAGVESEQAALGEEAVLLLDDIMAEVEVVAEEEGLVERREEAQRAQQAVPGPGPMTPESALEELLAVQVELEPVNAQARKAFSRQREKMERRRKPQLDRRGAVIQSVPGFWANVIANHPQMSALITDEDEDMLSYMVSLEVEEEKHPVHLCKIMLFFRSNPYFQNKVITKEYLVNITEYRASHSTPIEWYPDYEVEAYRRRHHNSSLNFFNWFSDHNFAGSNKIAESPDRSYVRTCGAIPCNTTRG"
misc_feature 324..>836 /gene="LOC124909015" /note="Nucleosome assembly protein (NAP); Region: NAP; cl08298" /db_xref="CDD:447601" variation 44 /gene="LOC124909015" /replace="c" /replace="t" /db_xref="dbSNP:1556183934" variation 152 /gene="LOC124909015" /replace="a" /replace="g" /db_xref="dbSNP:1259002950" variation 202 /gene="LOC124909015" /replace="a" /replace="g" /db_xref="dbSNP:1603143867" variation 205 /gene="LOC124909015" /replace="c" /replace="t" /db_xref="dbSNP:2016060887" variation 246 /gene="LOC124909015" /replace="a" /replace="g" /db_xref="dbSNP:2124354815" variation 276 /gene="LOC124909015" /replace="c" /replace="t" /db_xref="dbSNP:1348459055" variation 280 /gene="LOC124909015" /replace="a" /replace="g" /db_xref="dbSNP:1603143871" variation 309 /gene="LOC124909015" /replace="c" /replace="t" /db_xref="dbSNP:2124354826" variation 330 /gene="LOC124909015" /replace="a" /replace="c" /db_xref="dbSNP:1603143872" variation 343 /gene="LOC124909015" /replace="c" /replace="t" /db_xref="dbSNP:1317472486" variation 368 /gene="LOC124909015" /replace="c" /replace="g" /db_xref="dbSNP:1603143877" variation 414 /gene="LOC124909015" /replace="c" /replace="t" /db_xref="dbSNP:2124354836" variation 449 /gene="LOC124909015" /replace="c" /replace="g" /db_xref="dbSNP:1194474203" variation 463 /gene="LOC124909015" /replace="g" /replace="t" /db_xref="dbSNP:2124354841" variation 728 /gene="LOC124909015" /replace="a" /replace="g" /db_xref="dbSNP:1556183981" variation 756 /gene="LOC124909015" /replace="c" /replace="t" /db_xref="dbSNP:1556183985" variation 928 /gene="LOC124909015" /replace="a" /replace="g" /db_xref="dbSNP:1556183997" variation 939 /gene="LOC124909015" /replace="c" /replace="t" /db_xref="dbSNP:1556184001" ORIGIN
gcctggaagcccggcgcatgcgccctgagggctcgctgacctaccgggtgccagagaggctgcggcagggtttctgtggcgtgggtcgggcagcacaggccttggtgtgtgcgagtgccaaggagggcaccgccttcaggatggaggctgtacaggagggggcggccggggtggagagtgagcaggcggctttgggggaggaggcggtgctgctgttggatgacataatggcggaggtggaggtggtggcggaggaggagggcctcgtggagcggcgggaggaggcccagcgggcacagcaggctgtgcctggccctgggcccatgaccccagagtctgcactggaggagctgctggccgttcaggtggagctggagccggttaatgcccaagccaggaaggccttttctcggcagcgggaaaagatggagcggaggcgcaagccccagctagaccgcagaggcgccgtcatccagagcgtccctggcttctgggccaatgttattgcaaaccacccccagatgtcagccctgatcactgacgaagatgaagacatgctgagctacatggtcagcctggaggtggaagaagagaagcatcctgttcatctctgcaagatcatgttgttctttcggagtaacccctacttccagaataaagtgattaccaaggaatatctggtgaacatcacagaatacagggcttctcattccactccaattgagtggtatccggattatgaagtggaggcctatcgccgcagacaccacaacagcagccttaacttcttcaactggttctctgaccacaacttcgcaggatctaacaagattgctgagtcccctgacagatcctatgtaaggacctgtggcgcaatcccctgcaatactacaagaggatgaagccacctgaagagggaacagagacgtcaggggactcccagttgttga
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]