2024-05-01 12:34:34, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_006724929 1045 bp mRNA linear PRI 05-OCT-2023 DEFINITION PREDICTED: Homo sapiens inactive glutathione hydrolase 2 (LOC102724197), transcript variant X13, mRNA. ACCESSION XM_006724929 VERSION XM_006724929.3 DBLINK BioProject: PRJNA168 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NT_187386.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Apr 5, 2022 this sequence version replaced XM_006724929.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Updated annotation Annotation Name :: GCF_000001405.40-RS_2023_10 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.2 Annotation Method :: Best-placed RefSeq; Gnomon; RefSeqFE; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 10/02/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1045 /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="22" /map="unlocalized" gene 1..1045 /gene="LOC102724197" /note="inactive glutathione hydrolase 2; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins, and 92% coverage of the annotated genomic feature by RNAseq alignments, including 28 samples with support for all annotated introns" /db_xref="GeneID:102724197" variation 9 /gene="LOC102724197" /replace="c" /replace="t" /db_xref="dbSNP:2087122402" variation 42 /gene="LOC102724197" /replace="a" /replace="g" /db_xref="dbSNP:2087122496" variation 107 /gene="LOC102724197" /replace="a" /replace="g" /db_xref="dbSNP:2087127255" CDS 124..882 /gene="LOC102724197" /codon_start=1 /product="putative glutathione hydrolase light chain 3 isoform X7" /protein_id="XP_006724992.1" /db_xref="GeneID:102724197" /translation="
MTSEFFTAQLRSQISDHTTHPISYYKPEFYTPDDGGTAHLSVVAEDGSAVSATSTINLYFGSKVCSPVSGILFNNEWTTSALPAFTNEFGAPPSPANFIQPGKQPLLSMCPTIMVGQDGQVRMVVGAAGGTQITTDTALVCVTPFLPGPAHSAQPPSHADHTPMPQAIIYNLWFGYDVKRAVEEPRLHNKLLPNVTTVERNIDQAVTAALETRHHHTQIASTFIAVVQAIVRTAGGWAAASDSRKGGEPAGY"
misc_feature <124..864 /gene="LOC102724197" /note="Gamma-glutamyltranspeptidase; Region: G_glu_transpept; cl19223" /db_xref="CDD:450276" variation 142 /gene="LOC102724197" /replace="a" /replace="g" /db_xref="dbSNP:1556066369" polyA_site 1045 /gene="LOC102724197" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN
tgacgtactaccgcatcgtagaggctttccggtttgcctacgccaagaggaccctgcttggggaccccaagtttgtggatgtgactgaggccagctctggggtctcagcaggtggtccgcaacatgacctctgagttcttcactgcccagctccggtcccagatctctgaccacaccactcacccgatctcctactacaagcccgagttctacacgccggatgacgggggcactgctcacctgtctgtcgtcgcagaggacggcagtgctgtgtccgccaccagcaccatcaacctctactttggctccaaggtctgctccccggtcagtgggatcctgttcaataatgaatggacgacttcagctctcccagcattcaccaatgagtttggggcacccccctcacctgccaatttcatccagccagggaagcagccgctcttgtccatgtgcccgacgatcatggtgggccaggacggccaggtccggatggtggtgggagctgctgggggcacgcagatcaccacagacactgcactggtatgtgtcaccccttttctccctggccctgcccactctgcacagcccccaagccacgctgatcacactcccatgccccaggccatcatctacaacctctggttcggctatgacgtgaagagggccgtggaggagccccggctgcacaacaagcttctgcccaacgtcacgacagtggagagaaacattgaccaggcagtgactgcagccctggagacccggcaccatcacacccagatcgcgtccaccttcatcgctgtggtgcaagccatcgtccgcacggctggtggctgggcagctgcctcggactccaggaaaggcggggaacctgctggctactgagtgctccaggcagacaaggctgacaagcaatccagggacaagatactcaccaggatgaggaagaggactttgggggacgggcttcccctgtgagcagcagagcagcataataaatgaggccactgtgccaggctccaggtggcctccctggcctgtctcccca
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]