ver.2
Home
|
Help
|
Advanced search
Previous release (v1)
2024-04-30 10:36:15, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_173852 523 bp mRNA linear PRI 12-FEB-2023
DEFINITION Homo sapiens keratinocyte associated protein 2 (KRTCAP2), mRNA.
ACCESSION NM_173852
VERSION NM_173852.4
KEYWORDS RefSeq; MANE Select.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 523)
AUTHORS Sun P, Zhang H, Shi J, Xu M, Cheng T, Lu B, Yang L, Zhang X and
Huang J.
TITLE KRTCAP2 as an immunological and prognostic biomarker of
hepatocellular carcinoma
JOURNAL Colloids Surf B Biointerfaces 222, 113124 (2023)
PUBMED 36634487
REMARK GeneRIF: KRTCAP2 as an immunological and prognostic biomarker of
hepatocellular carcinoma.
REFERENCE 2 (bases 1 to 523)
AUTHORS Shrimal S, Cherepanova NA and Gilmore R.
TITLE DC2 and KCP2 mediate the interaction between the
oligosaccharyltransferase and the ER translocon
JOURNAL J Cell Biol 216 (11), 3625-3638 (2017)
PUBMED 28860277
REMARK GeneRIF: DC2 and KCP2 mediate the interaction between the
oligosaccharyltransferase STT3A and the endoplasmic reticulum
translocon.
REFERENCE 3 (bases 1 to 523)
AUTHORS Roboti P and High S.
TITLE The oligosaccharyltransferase subunits OST48, DAD1 and KCP2
function as ubiquitous and selective modulators of mammalian
N-glycosylation
JOURNAL J Cell Sci 125 (Pt 14), 3474-3484 (2012)
PUBMED 22467853
REFERENCE 4 (bases 1 to 523)
AUTHORS Roboti P and High S.
TITLE Keratinocyte-associated protein 2 is a bona fide subunit of the
mammalian oligosaccharyltransferase
JOURNAL J Cell Sci 125 (Pt 1), 220-232 (2012)
PUBMED 22266900
REMARK GeneRIF: data strongly support the proposal that KCP2 is a newly
identified subunit of the N-glycosylation machinery present in a
subset of eukaryotes
REFERENCE 5 (bases 1 to 523)
AUTHORS Shibatani T, David LL, McCormack AL, Frueh K and Skach WR.
TITLE Proteomic analysis of mammalian oligosaccharyltransferase reveals
multiple subcomplexes that contain Sec61, TRAP, and two potential
new subunits
JOURNAL Biochemistry 44 (16), 5982-5992 (2005)
PUBMED 15835887
REFERENCE 6 (bases 1 to 523)
AUTHORS Bonkobara M, Das A, Takao J, Cruz PD and Ariizumi K.
TITLE Identification of novel genes for secreted and membrane-anchored
proteins in human keratinocytes
JOURNAL Br J Dermatol 148 (4), 654-664 (2003)
PUBMED 12752121
COMMENT VALIDATED REFSEQ: This record has undergone validation or
preliminary review. The reference sequence was derived from
AL607067.17.
On Dec 2, 2019 this sequence version replaced NM_173852.3.
##Evidence-Data-START##
Transcript exon combination :: CB110825.1, CD386005.1 [ECO:0000332]
##Evidence-Data-END##
##RefSeq-Attributes-START##
CDS uses downstream in-frame AUG :: upstream AUG and CDS extension
is not conserved
MANE Ensembl match :: ENST00000295682.6/
ENSP00000295682.5
RefSeq Select criteria :: based on single protein-coding
transcript
##RefSeq-Attributes-END##
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-84 AL607067.17 31398-31481 c
85-239 AL607067.17 30915-31069 c
240-303 AL607067.17 30742-30805 c
304-370 AL607067.17 27968-28034 c
371-523 AL607067.17 27585-27737 c
FEATURES Location/Qualifiers
source 1..523
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="1"
/map="1q22"
gene 1..523
/gene="KRTCAP2"
/gene_synonym="KCP2"
/note="keratinocyte associated protein 2"
/db_xref="GeneID:200185"
/db_xref="HGNC:HGNC:28942"
/db_xref="MIM:619029"
exon 1..84
/gene="KRTCAP2"
/gene_synonym="KCP2"
/inference="alignment:Splign:2.1.0"
misc_feature 3..5
/gene="KRTCAP2"
/gene_synonym="KCP2"
/note="upstream_AUG_codon; putative N-terminal extension:
MRIANRTRFSSPFLARGAGWTHGRGM"
variation 3
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1665344485"
variation 7
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="c"
/replace="g"
/db_xref="dbSNP:1213631693"
variation 9
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:772669394"
variation 10
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1665344086"
variation 12
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="c"
/replace="g"
/db_xref="dbSNP:145673508"
variation 13
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1275898860"
variation 15
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:774006469"
variation 16
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="a"
/replace="t"
/db_xref="dbSNP:1373635177"
variation 17
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:371241351"
variation 18
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="a"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:777966860"
variation 20
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1349624312"
variation 22..24
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="cc"
/replace="ccc"
/db_xref="dbSNP:780731901"
variation 22
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:756161276"
variation 23
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:748190475"
variation 24
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="a"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:551900242"
variation 25
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:368223709"
variation 26
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:756992066"
variation 29
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="a"
/replace="c"
/db_xref="dbSNP:1410489739"
variation 30
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:556637431"
variation 31
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:1055874632"
variation 32
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:971807557"
variation 33
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="g"
/replace="t"
/db_xref="dbSNP:763739712"
variation 34
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:147936640"
variation 35
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:1156758147"
variation 36
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:775094540"
variation 37
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="a"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:538757076"
variation 39
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1323978697"
variation 41
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:760086496"
variation 44
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:774918779"
variation 45
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="g"
/replace="t"
/db_xref="dbSNP:1285967116"
variation 46
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1665340198"
variation 47
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:771405543"
variation 48
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1467789588"
variation 49
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="c"
/replace="g"
/db_xref="dbSNP:749608261"
variation 53
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:773310655"
variation 54
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:770015435"
variation 55
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="c"
/replace="g"
/db_xref="dbSNP:2147770661"
variation 56
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="c"
/replace="g"
/db_xref="dbSNP:1416345233"
variation 57
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:2147770656"
variation 60
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="g"
/replace="t"
/db_xref="dbSNP:748197573"
variation 62
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="g"
/replace="t"
/db_xref="dbSNP:781219335"
variation 63
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="a"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:745791834"
variation 64
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:141865060"
variation 65
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:904506895"
variation 66
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="c"
/replace="g"
/db_xref="dbSNP:1043681919"
variation 68
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:374855733"
variation 69..71
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="gg"
/replace="ggg"
/db_xref="dbSNP:779217122"
variation 69
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:144579240"
variation 70
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:988343008"
variation 72
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:763679588"
variation 73
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1456917439"
variation 74
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:1418770953"
variation 77
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:755767273"
misc_feature 78..80
/gene="KRTCAP2"
/gene_synonym="KCP2"
/note="upstream_AUG_codon; putative N-terminal extension:
M"
variation 78
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:756885976"
variation 79
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1256118970"
variation 80
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:767127109"
CDS 81..491
/gene="KRTCAP2"
/gene_synonym="KCP2"
/note="keratinocytes associated protein 2; KCP-2;
oligosaccharyl transferase subunit KCP2;
dolichyl-diphosphooligosaccharide--protein
glycosyltransferase subunit KCP2"
/codon_start=1
/product="keratinocyte-associated protein 2"
/protein_id="NP_776251.2"
/db_xref="CCDS:CCDS1096.2"
/db_xref="GeneID:200185"
/db_xref="HGNC:HGNC:28942"
/db_xref="MIM:619029"
/translation="
MVVGTGTSLALSSLLSLLLFAGMQMYSRQLASTEWLTIQGGLLGSGLFVFSLTAFNNLENLVFGKGFQAKIFPEILLCLLLALFASGLIHRVCVTTCFIFSMVGLYYINKISSTLYQAAAPVLTPAKVTGKSKKRN"
misc_feature 87..473
/gene="KRTCAP2"
/gene_synonym="KCP2"
/note="Keratinocyte-associated protein 2; Region:
Keratin_assoc; pfam09775"
/db_xref="CDD:401649"
misc_feature 96..149
/gene="KRTCAP2"
/gene_synonym="KCP2"
/note="propagated from UniProtKB/Swiss-Prot (Q8N6L1.2);
transmembrane region"
misc_feature 183..245
/gene="KRTCAP2"
/gene_synonym="KCP2"
/note="propagated from UniProtKB/Swiss-Prot (Q8N6L1.2);
transmembrane region"
misc_feature 306..404
/gene="KRTCAP2"
/gene_synonym="KCP2"
/note="propagated from UniProtKB/Swiss-Prot (Q8N6L1.2);
transmembrane region"
misc_feature 450..452
/gene="KRTCAP2"
/gene_synonym="KCP2"
/note="Phosphothreonine.
/evidence=ECO:0007744|PubMed:18669648,
ECO:0007744|PubMed:20068231, ECO:0007744|PubMed:23186163;
propagated from UniProtKB/Swiss-Prot (Q8N6L1.2);
phosphorylation site"
misc_feature 477..488
/gene="KRTCAP2"
/gene_synonym="KCP2"
/note="propagated from UniProtKB/Swiss-Prot (Q8N6L1.2);
Region: Prevents secretion from ER. /evidence=ECO:0000255"
variation 81
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="a"
/replace="t"
/db_xref="dbSNP:760174593"
variation 83
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="c"
/replace="g"
/db_xref="dbSNP:775010888"
variation 84
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="a"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:370529024"
exon 85..239
/gene="KRTCAP2"
/gene_synonym="KCP2"
/inference="alignment:Splign:2.1.0"
variation 87
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:777482951"
variation 88
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="g"
/replace="t"
/db_xref="dbSNP:1422137408"
variation 89
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="g"
/replace="t"
/db_xref="dbSNP:1307940513"
variation 90
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:775905434"
variation 91
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:200865365"
variation 92
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="g"
/replace="t"
/db_xref="dbSNP:1571720356"
variation 93
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1308037067"
variation 94
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="a"
/replace="c"
/db_xref="dbSNP:1571720326"
variation 95
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:2147769750"
variation 97
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="g"
/replace="t"
/db_xref="dbSNP:17854920"
variation 100
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:781023039"
variation 103
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:754626864"
variation 104
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="c"
/replace="g"
/db_xref="dbSNP:1173840748"
variation 105
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:751162422"
variation 109
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="c"
/replace="g"
/db_xref="dbSNP:1302131608"
variation 113
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="c"
/replace="g"
/db_xref="dbSNP:779612494"
variation 114
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="g"
/replace="t"
/db_xref="dbSNP:1311394186"
variation 115
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1665310164"
variation 116
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="c"
/replace="g"
/db_xref="dbSNP:758888558"
variation 118
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1665309725"
variation 120
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1368141718"
variation 122
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:1665309439"
variation 125
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="c"
/replace="g"
/db_xref="dbSNP:373294163"
variation 127
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:1665309143"
variation 128
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="c"
/replace="g"
/db_xref="dbSNP:765597106"
variation 129
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:762199641"
variation 132
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:770010273"
variation 137
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:754157270"
variation 140
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:11813"
variation 142
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:1258137261"
variation 144
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1665308210"
variation 146
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:764351701"
variation 151
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1665307896"
variation 153
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="a"
/replace="t"
/db_xref="dbSNP:918862966"
variation 155
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:11547202"
variation 157
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="a"
/replace="c"
/db_xref="dbSNP:1344373412"
variation 159
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="a"
/replace="t"
/db_xref="dbSNP:760858241"
variation 161
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="a"
/replace="c"
/db_xref="dbSNP:1241451486"
variation 162
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:1327263068"
variation 163
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:993077463"
variation 164
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1571720105"
variation 165
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="a"
/replace="c"
/db_xref="dbSNP:138648521"
variation 172
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:1288135807"
variation 173
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1415733629"
variation 179
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="a"
/replace="c"
/db_xref="dbSNP:1357945372"
variation 180
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="g"
/replace="t"
/db_xref="dbSNP:1665306354"
variation 182
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1441642970"
variation 185
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1179282796"
variation 186
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="c"
/replace="g"
/db_xref="dbSNP:1571720057"
variation 187
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="a"
/replace="t"
/db_xref="dbSNP:775497011"
variation 188
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:759471919"
variation 189
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="a"
/replace="aa"
/db_xref="dbSNP:777923895"
variation 190
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:773202333"
variation 191
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:369840909"
variation 192
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1400852446"
variation 194
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:1571720006"
variation 197
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="g"
/replace="t"
/db_xref="dbSNP:747979187"
variation 200
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:142437742"
variation 201
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="c"
/replace="g"
/db_xref="dbSNP:1034495138"
variation 202
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1158853755"
variation 203
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="c"
/replace="g"
/db_xref="dbSNP:1571719965"
variation 208
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1405089805"
variation 209
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="g"
/replace="t"
/db_xref="dbSNP:1571719957"
variation 210
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="c"
/replace="g"
/db_xref="dbSNP:1665304196"
variation 212
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="g"
/replace="t"
/db_xref="dbSNP:1571719950"
variation 214
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:768462233"
variation 215
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:746648555"
variation 218
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="g"
/replace="t"
/db_xref="dbSNP:1571719929"
variation 219
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1409237863"
variation 221
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1158189406"
variation 223
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1665302907"
variation 224
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="a"
/replace="c"
/db_xref="dbSNP:1665302780"
variation 230
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:1475395765"
variation 231
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="g"
/replace="t"
/db_xref="dbSNP:572752863"
variation 232
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:942235590"
variation 233
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:757931057"
exon 240..303
/gene="KRTCAP2"
/gene_synonym="KCP2"
/inference="alignment:Splign:2.1.0"
variation 240
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:1300406919"
variation 241
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1230041468"
variation 245
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1362385492"
variation 247
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:150295746"
variation 248
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1665294246"
variation 253
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1665294155"
variation 259
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:1441191088"
variation 263
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1415249990"
variation 267
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:200430293"
variation 269
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1212719289"
variation 271
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:746262811"
variation 272
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:967911295"
variation 274
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1321371214"
variation 286
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="c"
/replace="g"
/db_xref="dbSNP:200041628"
variation 291
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:749777798"
variation 293
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="c"
/replace="g"
/db_xref="dbSNP:1571719479"
variation 296
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1665292925"
variation 298
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1571719471"
variation 299
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="a"
/replace="t"
/db_xref="dbSNP:942534687"
exon 304..370
/gene="KRTCAP2"
/gene_synonym="KCP2"
/inference="alignment:Splign:2.1.0"
variation 308
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1210260737"
variation 309
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="c"
/replace="g"
/db_xref="dbSNP:1313413584"
variation 311
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:17854919"
variation 314
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="a"
/replace="c"
/db_xref="dbSNP:1210738369"
variation 315
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1268841436"
variation 318
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1665185019"
variation 324
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1665184976"
variation 327
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:1276135935"
variation 329
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1218268316"
variation 330
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1665184857"
variation 332
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:748593100"
variation 333
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1289997543"
variation 335
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="a"
/replace="t"
/db_xref="dbSNP:1665184732"
variation 337
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1571716125"
variation 343
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1464443379"
variation 344
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1407713769"
variation 349
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1665184441"
variation 350
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1665184389"
variation 351
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:199976320"
variation 352
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:372181365"
variation 354
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:1450368546"
variation 358
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="g"
/replace="t"
/db_xref="dbSNP:201575375"
variation 359
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:775067154"
variation 360
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1665183919"
variation 361
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="a"
/replace="t"
/db_xref="dbSNP:780356926"
variation 362
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="c"
/replace="cc"
/db_xref="dbSNP:1665183783"
variation 365
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="c"
/replace="g"
/db_xref="dbSNP:1665183714"
variation 366
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:758583765"
variation 367..368
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="c"
/replace="cc"
/db_xref="dbSNP:1401518803"
variation 368
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:1190943702"
exon 371..523
/gene="KRTCAP2"
/gene_synonym="KCP2"
/inference="alignment:Splign:2.1.0"
variation 374
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="c"
/replace="cc"
/db_xref="dbSNP:1416160995"
variation 376..381
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="tct"
/replace="tcttct"
/db_xref="dbSNP:765212411"
variation 377
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:374944263"
variation 380
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="a"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:768907029"
variation 382
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1265827039"
variation 387
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:200517433"
variation 388
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1665176022"
variation 390
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1319892367"
variation 394
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="g"
/replace="t"
/db_xref="dbSNP:1369697087"
variation 401
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:780448628"
variation 402
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:2147765827"
variation 406
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1229297585"
variation 411
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="a"
/replace="t"
/db_xref="dbSNP:1162608947"
variation 413..419
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="ctcc"
/replace="ctcctcc"
/db_xref="dbSNP:1434649174"
variation 416
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:758673456"
variation 418
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:745987678"
variation 420
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="a"
/replace="c"
/db_xref="dbSNP:1571715770"
variation 426
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1368501452"
variation 432
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:528947305"
variation 433
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:757269090"
variation 438
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1349849892"
variation 441
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:1169758552"
variation 442
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="c"
/replace="g"
/db_xref="dbSNP:752593729"
variation 444
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:767417973"
variation 446
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="c"
/replace="g"
/db_xref="dbSNP:754757064"
variation 447
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:1427580170"
variation 449
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1267568435"
variation 451
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:751303947"
variation 452
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1665174916"
variation 453
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:908331937"
variation 454
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1264858812"
variation 455
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1665174764"
variation 458
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="c"
/replace="g"
/db_xref="dbSNP:766068516"
variation 460
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="a"
/replace="c"
/db_xref="dbSNP:1275211749"
variation 462
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="g"
/replace="t"
/db_xref="dbSNP:762559421"
variation 466
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1272587653"
variation 468
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1227694216"
variation 469
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="g"
/replace="t"
/db_xref="dbSNP:1244108436"
variation 472
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1665174423"
variation 476
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:982903102"
variation 478
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:2147765774"
variation 488
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:772774857"
variation 493
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="a"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:764639348"
variation 495
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:2147765767"
variation 500
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1665174211"
regulatory 504..509
/regulatory_class="polyA_signal_sequence"
/gene="KRTCAP2"
/gene_synonym="KCP2"
/note="hexamer: AATAAA"
variation 505
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1557803068"
variation 506
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1367327546"
variation 507
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1344911235"
variation 509
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1229685105"
variation 511
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1557803062"
variation 513
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="g"
/replace="t"
/db_xref="dbSNP:1665174002"
variation 515..520
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="tt"
/replace="ttcttt"
/db_xref="dbSNP:761282454"
variation 515
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1274369010"
variation 517
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="c"
/replace="g"
/db_xref="dbSNP:1340403144"
variation 519
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:991437220"
variation 520
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1665173779"
variation 521
/gene="KRTCAP2"
/gene_synonym="KCP2"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:1553193160"
polyA_site 523
/gene="KRTCAP2"
/gene_synonym="KCP2"
/note="major polyA site"
ORIGIN
gcatgcgcatagctaaccgcacccggttcagctcgcctttcttggccagaggcgccggttggactcacgggcggggcatgatggtggtgggtacgggcacctcgctggcgctctcctccctcctgtccctgctgctctttgctgggatgcagatgtacagccgtcagctggcctccaccgagtggctcaccatccagggcggcctgcttggttcgggtctcttcgtgttctcgctcactgccttcaataatctggagaatcttgtctttggcaaaggattccaagcaaagatcttccctgagattctcctgtgcctcctgttggctctctttgcatctggcctcatccaccgagtctgtgtcaccacctgcttcatcttctccatggttggtctgtactacatcaacaagatctcctccaccctgtaccaggcagcagctccagtcctcacaccagccaaggtcacaggcaagagcaagaagagaaactgaccctgaatgttcaataaagttgattctttgta
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]