GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-03-29 15:52:58, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       NM_033520                374 bp    mRNA    linear   PRI 09-OCT-2023
DEFINITION  Homo sapiens chromosome 19 open reading frame 33 (C19orf33),
            transcript variant 1, mRNA.
ACCESSION   NM_033520 XM_085984
VERSION     NM_033520.3
KEYWORDS    RefSeq; MANE Select.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 374)
  AUTHORS   Luo Q, Pan Y, Fu Q, Zhang X, Zhou S, Yu P, Tian H, Liu P, Chen S,
            Zhang H and Qin T.
  TITLE     Immortalization-upregulated protein promotes pancreatic cancer
            progression by regulating NPM1/FHL1-mediated cell-cycle-checkpoint
            protein activity
  JOURNAL   Cell Biol Toxicol 39 (5), 2069-2087 (2023)
   PUBMED   35142956
  REMARK    GeneRIF: Immortalization-upregulated protein promotes pancreatic
            cancer progression by regulating NPM1/FHL1-mediated
            cell-cycle-checkpoint protein activity.
REFERENCE   2  (bases 1 to 374)
  AUTHORS   Jeon SY, Lee HJ, Na KH, Cha DH, Kim JK, Park JW, Yoon TK and Kim
            GJ.
  TITLE     Hypoxia-induced downregulation of XIAP in trophoblasts mediates
            apoptosis via interaction with IMUP-2: implications for placental
            development during pre-eclampsia
  JOURNAL   J Cell Biochem 114 (1), 89-98 (2013)
   PUBMED   22886722
  REMARK    GeneRIF: Hypoxia-induced down-regulation of XIAP mediates apoptosis
            in trophoblasts through interaction with increased IMUP-2; this
            mechanism underlies the pathogenesis of pre-eclampsia.
REFERENCE   3  (bases 1 to 374)
  AUTHORS   Jeon SY, Lee HJ, Park JM, Jung HM, Yoo JK, Lee HJ, Lee JS, Cha DH,
            Kim JK and Kim GJ.
  TITLE     Increased immortalization-upregulated protein 2 (IMUP-2) by hypoxia
            induces apoptosis of the trophoblast and pre-eclampsia
  JOURNAL   J Cell Biochem 110 (2), 522-530 (2010)
   PUBMED   20432246
  REMARK    GeneRIF: results suggest that IMUP-2 expression is specifically
            elevated in preterm pre-eclampsia and under hypoxic conditions, and
            that IMUP-2 induces apoptosis of the trophoblast
REFERENCE   4  (bases 1 to 374)
  AUTHORS   Kim SJ, An HJ, Kim HJ, Jungs HM, Lee S, Ko JJ, Kim IH, Sakuragi N
            and Kim JK.
  TITLE     Imup-1 and imup-2 overexpression in endometrial carcinoma in Korean
            and Japanese populations
  JOURNAL   Anticancer Res 28 (2A), 865-871 (2008)
   PUBMED   18507030
  REMARK    GeneRIF: These findings demonstrate the up-regulation of imup-1 and
            imup-2 in human endometrial carcinomas and indicate that these
            molecules play a role in endometrial carcinogenesis in both Korean
            and Japanese patients.
REFERENCE   5  (bases 1 to 374)
  AUTHORS   Betsunoh H, Mukai S, Akiyama Y, Fukushima T, Minamiguchi N, Hasui
            Y, Osada Y and Kataoka H.
  TITLE     Clinical relevance of hepsin and hepatocyte growth factor activator
            inhibitor type 2 expression in renal cell carcinoma
  JOURNAL   Cancer Sci 98 (4), 491-498 (2007)
   PUBMED   17309599
  REMARK    GeneRIF: Our findings suggest that the balance between hepsin and
            its inhibitor, HAI-2, may have prognostic value in RCC.
REFERENCE   6  (bases 1 to 374)
  AUTHORS   Naganuma S, Itoh H, Uchiyama S, Nagaike K, Tanaka H, Akiyama Y,
            Chijiiwa K and Kataoka H.
  TITLE     Nuclear translocation of H2RSP is impaired in regenerating
            intestinal epithelial cells of murine colitis model
  JOURNAL   Virchows Arch 448 (3), 354-360 (2006)
   PUBMED   16189703
  REMARK    GeneRIF: Nuclear translocation of H2RSP may be related to a
            signaling involved in the transition from cellular proliferation to
            differentiation in experimental murine colitis.
REFERENCE   7  (bases 1 to 374)
  AUTHORS   Kim JK, An HJ, Kim NK, Ahn JY, Kim KS, Kang YJ, Ko JJ, Oh D, Lee C,
            Kim SJ and Cha KY.
  TITLE     IMUP-1 and IMUP-2 genes are up-regulated in human ovarian
            epithelial tumors
  JOURNAL   Anticancer Res 23 (6C), 4709-4713 (2003)
   PUBMED   14981917
  REMARK    GeneRIF: results showed the up-regulation of IMUP-1 and IMUP-2 in
            human ovarian epithelial tumors and suggested that the altered mRNA
            level of these molecules is possibly associated with ovarian
            tumorigenesis
REFERENCE   8  (bases 1 to 374)
  AUTHORS   Naganuma S, Itoh H, Uchiyama S, Tanaka H, Nagaike K, Miyata S,
            Uchinokura S, Nuki Y, Akiyama Y, Chijiiwa K and Kataoka H.
  TITLE     Characterization of transcripts generated from mouse hepatocyte
            growth factor activator inhibitor type 2 (HAI-2) and HAI-2-related
            small peptide (H2RSP) genes: chimeric mRNA transcribed from both
            HAI-2 and H2RSP genes is detected in human but not in mouse
  JOURNAL   Biochem Biophys Res Commun 302 (2), 345-353 (2003)
   PUBMED   12604353
REFERENCE   9  (bases 1 to 374)
  AUTHORS   Itoh H, Kataoka H, Yamauchi M, Naganuma S, Akiyama Y, Nuki Y,
            Shimomura T, Miyazawa K, Kitamura N and Koono M.
  TITLE     Identification of hepatocyte growth factor activator inhibitor type
            2 (HAI-2)-related small peptide (H2RSP): its nuclear localization
            and generation of chimeric mRNA transcribed from both HAI-2 and
            H2RSP genes
  JOURNAL   Biochem Biophys Res Commun 288 (2), 390-399 (2001)
   PUBMED   11606055
  REMARK    GeneRIF: H2RSP and H2RSP/HAI-2 chimeric peptides might function as
            a transcriptional regulatory peptide at the nucleus.
REFERENCE   10 (bases 1 to 374)
  AUTHORS   Kim JK, Ryll R, Ishizuka Y and Kato S.
  TITLE     Identification of cDNAs encoding two novel nuclear proteins, IMUP-1
            and IMUP-2, upregulated in SV40-immortalized human fibroblasts
  JOURNAL   Gene 257 (2), 327-334 (2000)
   PUBMED   11080599
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from AF213678.1 and CB109881.1.
            
            On Nov 22, 2018 this sequence version replaced NM_033520.2.
            
            Summary: The protein encoded by this gene has been shown to be
            upregulated in SV40-immortalized fibroblasts as well as in
            endometrial carcinoma cells. The encoded protein is found primarily
            in the nucleus. This protein may play a role in placental
            development and diseases such as pre-eclampsia. Two transcript
            variants encoding different isoforms have been found for this gene.
            [provided by RefSeq, Dec 2015].
            
            Transcript Variant: This variant (1) encodes the longer isoform
            (IMUP-1).
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: AB038317.1, BG287159.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA1966682, SAMEA1968189
                                           [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            MANE Ensembl match     :: ENST00000301246.10/ ENSP00000301246.4
            RefSeq Select criteria :: based on conservation, expression,
                                      longest protein
            ##RefSeq-Attributes-END##
            COMPLETENESS: full length.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-5                 AF213678.1         91-95
            6-374               CB109881.1         1-369
FEATURES             Location/Qualifiers
     source          1..374
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="19"
                     /map="19q13.2"
     gene            1..374
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /note="chromosome 19 open reading frame 33"
                     /db_xref="GeneID:64073"
                     /db_xref="HGNC:HGNC:16668"
                     /db_xref="MIM:619711"
     exon            1..33
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /inference="alignment:Splign:2.1.0"
     variation       1
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:771799308"
     variation       2
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1377799296"
     variation       3
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1185535389"
     variation       5
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:2304176"
     variation       6
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:975814498"
     variation       9
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1250611647"
     variation       10
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1968883613"
     CDS             12..332
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /note="isoform IMUP-1 is encoded by transcript variant 1;
                     immortalization-upregulated protein; HAI-2 related small
                     protein; immortalization up-regulated protein; hepatocyte
                     growth factor activator inhibitor type 2-related small
                     protein"
                     /codon_start=1
                     /product="immortalization up-regulated protein isoform
                     IMUP-1"
                     /protein_id="NP_277055.1"
                     /db_xref="CCDS:CCDS12511.1"
                     /db_xref="GeneID:64073"
                     /db_xref="HGNC:HGNC:16668"
                     /db_xref="MIM:619711"
                     /translation="
MEFDLGAALEPTSQKPGVGAGHGGDPKLSPHKVQGRSEAGAGPGPKQGHHSSSDSSSSSSDSDTDVKSHAAGSKQHESIPGKAKKPKVKKKEKGKKEKGKKKEAPH"
     misc_feature    12..329
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /note="propagated from UniProtKB/Swiss-Prot (Q9GZP8.1);
                     Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
     misc_feature    12..248
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /note="Immortalisation up-regulated protein; Region: IMUP;
                     pfam15761"
                     /db_xref="CDD:434915"
     misc_feature    12..14
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /note="N-acetylmethionine.
                     /evidence=ECO:0007744|PubMed:20068231; propagated from
                     UniProtKB/Swiss-Prot (Q9GZP8.1); acetylation site"
     misc_feature    96..98
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /note="Phosphoserine.
                     /evidence=ECO:0007744|PubMed:23186163; propagated from
                     UniProtKB/Swiss-Prot (Q9GZP8.1); phosphorylation site"
     variation       13
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1197009956"
     variation       17
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1336836322"
     variation       20
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1278533796"
     variation       21
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1311771090"
     variation       22
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:2146288733"
     variation       24
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1968884309"
     exon            34..149
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /inference="alignment:Splign:2.1.0"
     variation       34
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1968888930"
     variation       36
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1303646839"
     variation       37
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1161229137"
     variation       38
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:764807460"
     variation       42
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1036310233"
     variation       44
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1968889670"
     variation       45
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1259333355"
     variation       46..47
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace=""
                     /replace="t"
                     /db_xref="dbSNP:1968889991"
     variation       49
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:531365851"
     variation       54
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:762121560"
     variation       55
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:901395702"
     variation       57
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:149154861"
     variation       59
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:572168647"
     variation       60
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:371716289"
     variation       63
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2146289064"
     variation       65..69
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="gggg"
                     /replace="ggggg"
                     /replace="gggggg"
                     /db_xref="dbSNP:1236963252"
     variation       65
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:780165916"
     variation       66
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:375904286"
     variation       68
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:369719001"
     variation       69
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1968891392"
     variation       70
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1424258888"
     variation       71
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1467079885"
     variation       72
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1968891769"
     variation       77
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1300026178"
     variation       78..82
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="ggggg"
                     /replace="gggggg"
                     /db_xref="dbSNP:35282731"
     variation       78
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:532051981"
     variation       80
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:779216511"
     variation       82
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:747979155"
     variation       83
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:771859056"
     variation       84
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:547355038"
     variation       86
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:746951877"
     variation       91
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1279164028"
     variation       92
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1873389911"
     variation       93
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1320654604"
     variation       94
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:2146289218"
     variation       95
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1232052769"
     variation       99
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:770417120"
     variation       100
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1289756408"
     variation       103
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1294555538"
     variation       108
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1005334176"
     variation       109
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1968893892"
     variation       115..125
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="g"
                     /replace="gccggtcggag"
                     /db_xref="dbSNP:1968894164"
     variation       115
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:565666445"
     variation       116
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:758991899"
     variation       117
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1968894481"
     variation       118
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1248112388"
     variation       119
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1968894716"
     variation       120
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:2146289307"
     variation       121
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:373145066"
     variation       122
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1391612621"
     variation       125
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:375165148"
     variation       132
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:762128437"
     variation       133
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1968895446"
     variation       135
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1478666290"
     variation       137
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace=""
                     /replace="t"
                     /db_xref="dbSNP:1385329842"
     variation       137
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1160092390"
     variation       138
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1968896104"
     variation       139
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1161429791"
     variation       140
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1412970127"
     variation       141
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1406081288"
     variation       142
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1600368257"
     variation       149
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1968896700"
     exon            150..212
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /inference="alignment:Splign:2.1.0"
     variation       150
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1262958689"
     variation       151
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:756964458"
     variation       152
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1211797297"
     variation       160
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="a"
                     /replace="aa"
                     /db_xref="dbSNP:1968906219"
     variation       161
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:2146289965"
     variation       163
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:781151590"
     variation       167
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:745785879"
     variation       168
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:865978007"
     variation       169..170
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="c"
                     /replace="cc"
                     /db_xref="dbSNP:1968906954"
     variation       169
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1600369202"
     variation       170
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1457215599"
     variation       171
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1968907233"
     variation       172
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:755675161"
     variation       184
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:779533389"
     variation       188
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1968907637"
     variation       191
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:759903274"
     variation       192
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:928454221"
     variation       196
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1198468746"
     variation       197
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:768366842"
     variation       198
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1276586239"
     variation       200
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1968908613"
     variation       202
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1555718871"
     variation       203..204
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="g"
                     /replace="gg"
                     /db_xref="dbSNP:758405299"
     variation       203
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:773823889"
     variation       204
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1218784912"
     variation       209
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:571106008"
     variation       212
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:942728571"
     exon            213..374
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /inference="alignment:Splign:2.1.0"
     variation       215
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:750229188"
     variation       216
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1306441801"
     variation       218
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1196226004"
     variation       219
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:760412340"
     variation       222
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:766369153"
     variation       224
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1968922821"
     variation       225
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:146775455"
     variation       229
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:754564247"
     variation       230
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1327120263"
     variation       231
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1968923256"
     variation       232..246
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="agca"
                     /replace="agcagcacgagagca"
                     /db_xref="dbSNP:777950636"
     variation       232
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:575882929"
     variation       234
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1348445221"
     variation       236
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1156534826"
     variation       239
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:7248001"
     variation       242
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1968924222"
     variation       244
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:777520578"
     variation       245
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:746268586"
     variation       248
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:770255035"
     variation       249
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:780664241"
     variation       250
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:749749901"
     variation       251
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:774295813"
     variation       252
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:376043011"
     variation       253
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1968925268"
     variation       254
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:772301397"
     variation       257
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:565067839"
     variation       265
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:773381141"
     variation       268
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1351819884"
     variation       270..272
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="aa"
                     /replace="aaa"
                     /db_xref="dbSNP:1437539155"
     variation       270
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1968925748"
     variation       271
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1218419961"
     variation       273
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1254579970"
     variation       274..276
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace=""
                     /replace="tga"
                     /db_xref="dbSNP:1968926387"
     variation       275..284
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="gaag"
                     /replace="gaagaag"
                     /replace="gaagaagaag"
                     /replace="gaagaagaagaag"
                     /db_xref="dbSNP:139805446"
     variation       275
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1239019301"
     variation       276..299
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="aagaag"
                     /replace="aagaagaaggagaagggcaagaag"
                     /db_xref="dbSNP:781666590"
     variation       277..291
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="agaagaaggagaagg"
                     /replace="agaagaaggagaaggagaagaaggagaagg"
                     /db_xref="dbSNP:1968927240"
     variation       277
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1600370674"
     variation       279..314
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="aagaaggagaagggcaagaag"
                     /replace="aagaaggagaagggcaagaaggagaagggcaagaag"
                     /replace="aagaaggagaagggcaagaaggagaagggcaagaaggagaagggcaag
                     aag"
                     /replace="aagaaggagaagggcaagaaggagaagggcaagaaggagaagggcaag
                     aaggagaagggcaagaag"
                     /db_xref="dbSNP:147127327"
     variation       279..284
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="aagaag"
                     /replace="aagaagaagggcaagaag"
                     /db_xref="dbSNP:1555718998"
     variation       279..283
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="aagaa"
                     /replace="aagaaagagaagggcaagaa"
                     /db_xref="dbSNP:1968928014"
     variation       279..281
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="aag"
                     /replace="aaggagaagggcaag"
                     /replace="aaggaggagaagggcaag"
                     /db_xref="dbSNP:1555718995"
     variation       279..280
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace=""
                     /replace="aa"
                     /db_xref="dbSNP:745359062"
     variation       279..280
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="aa"
                     /replace="aaaaaggagaagggcaa"
                     /db_xref="dbSNP:1968927539"
     variation       279
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="a"
                     /replace="aggaaggagaagggca"
                     /db_xref="dbSNP:1555718994"
     variation       280..291
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="agaagg"
                     /replace="agaaggagaagg"
                     /db_xref="dbSNP:760138019"
     variation       280
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:577046967"
     variation       281
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:760502279"
     variation       282..296
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="aaggagaagggcaag"
                     /replace="aaggagaagggcaaggagaagggcaag"
                     /db_xref="dbSNP:2146291231"
     variation       282
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:79297344"
     variation       283..302
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="ag"
                     /replace="aggagaagggcaagaaggag"
                     /db_xref="dbSNP:1362655899"
     variation       283..287
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="ag"
                     /replace="aggag"
                     /db_xref="dbSNP:201239475"
     variation       284..285
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="g"
                     /replace="gg"
                     /db_xref="dbSNP:869142620"
     variation       284
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1245501450"
     variation       285..298
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="gagaagggcaagaa"
                     /replace="gagaagggcaagaatgagaagggcaagaa"
                     /db_xref="dbSNP:1555719010"
     variation       285..288
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="gaga"
                     /replace="gagaga"
                     /db_xref="dbSNP:1555719030"
     variation       285
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:150469805"
     variation       289..302
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="agggcaagaaggag"
                     /replace="agggcaagaaggagggcaagaaggag"
                     /db_xref="dbSNP:776725232"
     variation       290..303
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="gggcaagaaggaga"
                     /replace="gggcaagaaggagaggggcaagaaggaga"
                     /db_xref="dbSNP:1555719036"
     variation       291..304
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="ggcaagaaggagaa"
                     /replace="ggcaagaaggagaatggcaagaaggagaa"
                     /db_xref="dbSNP:759395014"
     variation       291
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1356959911"
     variation       292
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1968930764"
     variation       293
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:763258267"
     variation       294..320
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="aagaaggag"
                     /replace="aagaaggagaagggcaagaagaaggag"
                     /db_xref="dbSNP:765192304"
     variation       294..299
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="aag"
                     /replace="aagaag"
                     /db_xref="dbSNP:752832965"
     variation       296
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1968931427"
     variation       297
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:776688714"
     variation       298..302
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="ag"
                     /replace="aggag"
                     /db_xref="dbSNP:758696451"
     variation       298
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1064155"
     variation       299
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:200319757"
     variation       300..313
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="gagaagggcaagaa"
                     /replace="gagaagggcaagaaagagaagggcaagaa"
                     /db_xref="dbSNP:1568350744"
     variation       300
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1064154"
     variation       301..318
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="agaagggcaagaagaagg"
                     /replace="agaagggcaagaagaagggcaagaagaagg"
                     /db_xref="dbSNP:1568350755"
     variation       301..305
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="ag"
                     /replace="agaag"
                     /db_xref="dbSNP:1568350762"
     variation       302..306
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="gaagg"
                     /replace="gaaggaagg"
                     /db_xref="dbSNP:1379309945"
     variation       302
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1439883359"
     variation       304..321
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="agg"
                     /replace="agggcaagaagaaggagg"
                     /db_xref="dbSNP:764245255"
     variation       305
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1968933246"
     variation       306
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:759396299"
     variation       307..314
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="gcaagaag"
                     /replace="gcaagaaggagaagagcaagaag"
                     /db_xref="dbSNP:751589318"
     variation       308
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1568350802"
     variation       309..317
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="aagaag"
                     /replace="aagaagaag"
                     /replace="aagaagaagaag"
                     /db_xref="dbSNP:201974576"
     variation       309
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1465333658"
     variation       311
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1600371187"
     variation       312..314
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="aag"
                     /replace="aaggagaagggcaag"
                     /db_xref="dbSNP:781654138"
     variation       313..314
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="ag"
                     /replace="aggag"
                     /db_xref="dbSNP:746439270"
     variation       313
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1186860281"
     variation       314..315
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace=""
                     /replace="gagaagggc"
                     /db_xref="dbSNP:780443998"
     variation       314
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1568350843"
     variation       314
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="g"
                     /replace="gg"
                     /db_xref="dbSNP:756436068"
     variation       315..316
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace=""
                     /replace="gaagggcaagaagg"
                     /db_xref="dbSNP:749632171"
     variation       315
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:76762399"
     variation       318..319
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace=""
                     /replace="gcaaga"
                     /db_xref="dbSNP:772748463"
     variation       318
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:199853866"
     variation       318
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="g"
                     /replace="ggcaag"
                     /db_xref="dbSNP:771711846"
     variation       319
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:757944166"
     variation       320..331
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="g"
                     /replace="ggctccccactg"
                     /db_xref="dbSNP:746473684"
     variation       320..321
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="gg"
                     /replace="ggg"
                     /db_xref="dbSNP:1260798693"
     variation       320
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:139591787"
     variation       321
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:146725585"
     variation       322..326
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="c"
                     /replace="ctccc"
                     /db_xref="dbSNP:1968936220"
     variation       324..327
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="cc"
                     /replace="cccc"
                     /db_xref="dbSNP:770626657"
     variation       325
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:751237883"
     variation       326
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1377952028"
     variation       327
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1225731687"
     variation       328
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1968936943"
     variation       329
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:764199878"
     variation       336
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:926809884"
     variation       339
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1312043609"
     variation       340
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:756563479"
     variation       341
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1265561942"
     variation       342
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:749596098"
     variation       344
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1268560665"
     variation       345
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1968937967"
     variation       348
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1196245202"
     variation       349
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:370764536"
     regulatory      352..357
                     /regulatory_class="polyA_signal_sequence"
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /note="hexamer: ATTAAA"
     variation       352
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1296751080"
     variation       353
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:779340118"
     variation       357
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1178618107"
     variation       359
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:546335416"
     variation       360
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1968938966"
     variation       362
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1968939088"
     variation       364
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1432398890"
     variation       365
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1968939373"
     variation       370
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:748256376"
     polyA_site      374
                     /gene="C19orf33"
                     /gene_synonym="H2RSP; IMUP; IMUP-1; IMUP-2"
                     /note="major polyA site"
ORIGIN      
ctcttaccgccatggagttcgacctgggagcagccctggagcccacctcccagaagcccggtgtgggggcgggccacgggggagatcccaagctcagtccccacaaagttcagggccggtcggaggcaggggcaggtccgggtccaaagcaaggacaccacagctcttccgactccagcagcagctccagcgattcggacacggatgtgaagtcccacgctgctggctccaagcagcacgagagcatcccgggcaaggccaagaagcccaaagtgaagaagaaggagaagggcaagaaggagaagggcaagaagaaggaggctccccactgaagggccctggacagggctcattaaaccttcctctctgccttc
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]