ver.2
Home
|
Help
|
Advanced search
Previous release (v1)
2024-04-26 13:19:09, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_003308 1161 bp mRNA linear PRI 25-MAR-2023
DEFINITION Homo sapiens testis specific protein Y-linked 1 (TSPY1), transcript
variant 1, mRNA.
ACCESSION NM_003308
VERSION NM_003308.4
KEYWORDS RefSeq; MANE Select.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 1161)
AUTHORS Paladhi P, Dutta S, Pal S, Bose G, Ghosh P, Chattopadhyay R,
Chakravarty B, Saha I and Ghosh S.
TITLE Novel Mutations of TSPY1 Gene Associate Spermatogenic Failure Among
Men
JOURNAL Reprod Sci 29 (4), 1241-1261 (2022)
PUBMED 35041134
REMARK GeneRIF: Novel Mutations of TSPY1 Gene Associate Spermatogenic
Failure Among Men.
REFERENCE 2 (bases 1 to 1161)
AUTHORS Leng X, Liu M, Tao D, Yang B, Zhang Y, He T, Xie S, Wang Z, Liu Y
and Yang Y.
TITLE Epigenetic modification-dependent androgen receptor occupancy
facilitates the ectopic TSPY1 expression in prostate cancer cells
JOURNAL Cancer Sci 112 (2), 691-702 (2021)
PUBMED 33185915
REMARK GeneRIF: Epigenetic modification-dependent androgen receptor
occupancy facilitates the ectopic TSPY1 expression in prostate
cancer cells.
REFERENCE 3 (bases 1 to 1161)
AUTHORS Giguere K, Leblond FA, Goma-Matsetse E, Dave V, Behanzin L, Guedou
FA and Alary M.
TITLE A novel nested polymerase chain reaction targeting the
testis-specific protein Y-encoded family of genes for high
sensitivity of recent semen exposure detection: Comparison with
four other assays of semen detection
JOURNAL PLoS One 14 (7), e0220326 (2019)
PUBMED 31344101
REMARK GeneRIF: Compared to n-TSPY, all other PCR assays had poor
performance to detect semen exposure. The n-TSPY is an accessible
assay that may have great utility in assessing semen exposure in
studies where many factors are expected to accelerate biomarkers'
clearance.
Publication Status: Online-Only
REFERENCE 4 (bases 1 to 1161)
AUTHORS Tu W, Yang B, Leng X, Pei X, Xu J, Liu M, Dong Q, Tao D, Lu Y, Liu
Y and Yang Y.
TITLE Testis-specific protein, Y-linked 1 activates PI3K/AKT and RAS
signaling pathways through suppressing IGFBP3 expression during
tumor progression
JOURNAL Cancer Sci 110 (5), 1573-1586 (2019)
PUBMED 30815935
REMARK GeneRIF: Experimental evidence establishes TSPY1 as an oncogenic
factor that facilitates tumor progression and causes poor prognosis
in male patients with lung adenocarcinoma or hepatocellular
carcinoma. These findings revealed that TSPY1 strongly promotes the
activation of the PI3K/AKT and RAS signaling pathways through
suppressing IGFBP3 gene transcription.
REFERENCE 5 (bases 1 to 1161)
AUTHORS Xue Y and Tyler-Smith C.
TITLE An Exceptional Gene: Evolution of the TSPY Gene Family in Humans
and Other Great Apes
JOURNAL Genes (Basel) 2 (1), 36-47 (2011)
PUBMED 24710137
REMARK Publication Status: Online-Only
REFERENCE 6 (bases 1 to 1161)
AUTHORS Krick R, Jakubiczka S and Arnemann J.
TITLE Expression, alternative splicing and haplotype analysis of
transcribed testis specific protein (TSPY) genes
JOURNAL Gene 302 (1-2), 11-19 (2003)
PUBMED 12527192
REFERENCE 7 (bases 1 to 1161)
AUTHORS Zhang JS, Yang-Feng TL, Muller U, Mohandas TK, de Jong PJ and Lau
YF.
TITLE Molecular isolation and characterization of an expressed gene from
the human Y chromosome
JOURNAL Hum Mol Genet 1 (9), 717-726 (1992)
PUBMED 1284595
REFERENCE 8 (bases 1 to 1161)
AUTHORS Guttenbach M, Muller U and Schmid M.
TITLE A human moderately repeated Y-specific DNA sequence is
evolutionarily conserved in the Y chromosome of the great apes
JOURNAL Genomics 13 (2), 363-367 (1992)
PUBMED 1612595
REFERENCE 9 (bases 1 to 1161)
AUTHORS Arnemann J, Jakubiczka S, Thuring S and Schmidtke J.
TITLE Cloning and sequence analysis of a human Y-chromosome-derived,
testicular cDNA, TSPY
JOURNAL Genomics 11 (1), 108-114 (1991)
PUBMED 1765369
REFERENCE 10 (bases 1 to 1161)
AUTHORS Arnemann J, Epplen JT, Cooke HJ, Sauermann U, Engel W and Schmidtke
J.
TITLE A human Y-chromosomal DNA sequence expressed in testicular tissue
JOURNAL Nucleic Acids Res 15 (21), 8713-8724 (1987)
PUBMED 3479749
COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The
reference sequence was derived from AC006156.5.
This sequence is a reference standard in the RefSeqGene project.
On Mar 10, 2016 this sequence version replaced NM_003308.3.
Summary: The protein encoded by this gene is found only in
testicular tissue and may be involved in spermatogenesis. Many
functional paralogs and pseudogenes of this gene are present in a
cluster in humans, but only a single, nonfunctional orthologous
gene is found in mouse. Alternative splicing results in multiple
transcript variants. [provided by RefSeq, Mar 2016].
Transcript Variant: This variant (1) encodes the longer isoform
(TSPY-S).
Sequence Note: The RefSeq transcript and protein were derived from
genomic sequence to make the sequence consistent with the reference
genome assembly. The genomic coordinates used for the transcript
record were based on alignments.
Publication Note: This RefSeq record includes a subset of the
publications that are available for this gene. Please see the Gene
record to access additional publications.
##Evidence-Data-START##
RNAseq introns :: single sample supports all introns SAMEA1968968,
SAMEA2148093 [ECO:0000348]
##Evidence-Data-END##
##RefSeq-Attributes-START##
MANE Ensembl match :: ENST00000451548.6/ ENSP00000403304.1
RefSeq Select criteria :: based on conservation, expression
##RefSeq-Attributes-END##
COMPLETENESS: complete on the 3' end.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-532 AC006156.5 13242-13773
533-610 AC006156.5 14381-14458
611-722 AC006156.5 14587-14698
723-868 AC006156.5 14800-14945
869-950 AC006156.5 15052-15133
951-1161 AC006156.5 15826-16036
FEATURES Location/Qualifiers
source 1..1161
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="Y"
/map="Yp11.2"
gene 1..1161
/gene="TSPY1"
/gene_synonym="CT78; DYS14; pJA923; TSPY"
/note="testis specific protein Y-linked 1"
/db_xref="GeneID:7258"
/db_xref="HGNC:HGNC:12381"
/db_xref="MIM:480100"
exon 1..532
/gene="TSPY1"
/gene_synonym="CT78; DYS14; pJA923; TSPY"
/inference="alignment:Splign:2.1.0"
variation 8
/gene="TSPY1"
/gene_synonym="CT78; DYS14; pJA923; TSPY"
/replace="c"
/replace="g"
/db_xref="dbSNP:1556182097"
variation 17
/gene="TSPY1"
/gene_synonym="CT78; DYS14; pJA923; TSPY"
/replace="a"
/replace="t"
/db_xref="dbSNP:1603142441"
variation 21
/gene="TSPY1"
/gene_synonym="CT78; DYS14; pJA923; TSPY"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:1379118618"
variation 22
/gene="TSPY1"
/gene_synonym="CT78; DYS14; pJA923; TSPY"
/replace="c"
/replace="t"
/db_xref="dbSNP:1603142449"
variation 29
/gene="TSPY1"
/gene_synonym="CT78; DYS14; pJA923; TSPY"
/replace="c"
/replace="t"
/db_xref="dbSNP:1394730875"
variation 30
/gene="TSPY1"
/gene_synonym="CT78; DYS14; pJA923; TSPY"
/replace="a"
/replace="g"
/db_xref="dbSNP:1603142459"
variation 38
/gene="TSPY1"
/gene_synonym="CT78; DYS14; pJA923; TSPY"
/replace="c"
/replace="g"
/db_xref="dbSNP:1290917158"
CDS 47..973
/gene="TSPY1"
/gene_synonym="CT78; DYS14; pJA923; TSPY"
/note="isoform TSPY-S is encoded by transcript variant 1;
cancer/testis antigen 78; testis-specific Y-encoded
protein 1; testis specific protein, Y-linked"
/codon_start=1
/product="testis-specific Y-encoded protein 1 isoform
TSPY-S"
/protein_id="NP_003299.2"
/db_xref="CCDS:CCDS48205.1"
/db_xref="GeneID:7258"
/db_xref="HGNC:HGNC:12381"
/db_xref="MIM:480100"
/translation="
MRPEGSLTYRVPERLRQGFCGVGRAAQALVCASAKEGTAFRMEAVQEGAAGVESEQAALGEEAVLLLDDIMAEVEVVAEEEGLVERREEAQRAQQAVPGPGPMTPESAPEELLAVQVELEPVNAQARKAFSRQREKMERRRKPHLDRRGAVIQSVPGFWANVIANHPQMSALITDEDEDMLSYMVSLEVGEEKHPVHLCKIMLFFRSNPYFQNKVITKEYLVNITEYRASHSTPIEWYPDYEVEAYRRRHHNSSLNFFNWFSDHNFAGSNKIAEILCKDLWRNPLQYYKRMKPPEEGTETSGDSQLLS"
misc_feature 422..910
/gene="TSPY1"
/gene_synonym="CT78; DYS14; pJA923; TSPY"
/note="Nucleosome assembly protein (NAP); Region: NAP;
cl08298"
/db_xref="CDD:447601"
variation 58
/gene="TSPY1"
/gene_synonym="CT78; DYS14; pJA923; TSPY"
/replace="g"
/replace="t"
/db_xref="dbSNP:1603142470"
variation 60
/gene="TSPY1"
/gene_synonym="CT78; DYS14; pJA923; TSPY"
/replace="a"
/replace="g"
/db_xref="dbSNP:1556182135"
variation 67
/gene="TSPY1"
/gene_synonym="CT78; DYS14; pJA923; TSPY"
/replace="g"
/replace="t"
/db_xref="dbSNP:1603142485"
variation 73
/gene="TSPY1"
/gene_synonym="CT78; DYS14; pJA923; TSPY"
/replace="c"
/replace="t"
/db_xref="dbSNP:754351883"
variation 85
/gene="TSPY1"
/gene_synonym="CT78; DYS14; pJA923; TSPY"
/replace="a"
/replace="g"
/db_xref="dbSNP:1603142497"
variation 179
/gene="TSPY1"
/gene_synonym="CT78; DYS14; pJA923; TSPY"
/replace="c"
/replace="g"
/db_xref="dbSNP:2124352953"
variation 181
/gene="TSPY1"
/gene_synonym="CT78; DYS14; pJA923; TSPY"
/replace="a"
/replace="g"
/db_xref="dbSNP:1218701068"
variation 187..191
/gene="TSPY1"
/gene_synonym="CT78; DYS14; pJA923; TSPY"
/replace="gggg"
/replace="ggggg"
/db_xref="dbSNP:1257071390"
variation 194
/gene="TSPY1"
/gene_synonym="CT78; DYS14; pJA923; TSPY"
/replace="g"
/replace="t"
/db_xref="dbSNP:1603142511"
variation 258
/gene="TSPY1"
/gene_synonym="CT78; DYS14; pJA923; TSPY"
/replace="g"
/replace="t"
/db_xref="dbSNP:2016041408"
variation 268
/gene="TSPY1"
/gene_synonym="CT78; DYS14; pJA923; TSPY"
/replace="a"
/replace="g"
/db_xref="dbSNP:1305374581"
variation 276
/gene="TSPY1"
/gene_synonym="CT78; DYS14; pJA923; TSPY"
/replace="g"
/replace="t"
/db_xref="dbSNP:2016041540"
variation 290
/gene="TSPY1"
/gene_synonym="CT78; DYS14; pJA923; TSPY"
/replace="a"
/replace="g"
/db_xref="dbSNP:1603142522"
variation 298
/gene="TSPY1"
/gene_synonym="CT78; DYS14; pJA923; TSPY"
/replace="a"
/replace="g"
/db_xref="dbSNP:1211999813"
variation 303
/gene="TSPY1"
/gene_synonym="CT78; DYS14; pJA923; TSPY"
/replace="a"
/replace="g"
/db_xref="dbSNP:777840135"
variation 306..308
/gene="TSPY1"
/gene_synonym="CT78; DYS14; pJA923; TSPY"
/replace="ggg"
/replace="gggg"
/db_xref="dbSNP:2124353015"
variation 311
/gene="TSPY1"
/gene_synonym="CT78; DYS14; pJA923; TSPY"
/replace="g"
/replace="t"
/db_xref="dbSNP:1482895379"
variation 314
/gene="TSPY1"
/gene_synonym="CT78; DYS14; pJA923; TSPY"
/replace="a"
/replace="g"
/db_xref="dbSNP:765624506"
variation 315
/gene="TSPY1"
/gene_synonym="CT78; DYS14; pJA923; TSPY"
/replace="c"
/replace="t"
/db_xref="dbSNP:753013820"
variation 321
/gene="TSPY1"
/gene_synonym="CT78; DYS14; pJA923; TSPY"
/replace="c"
/replace="g"
/db_xref="dbSNP:758060583"
variation 335
/gene="TSPY1"
/gene_synonym="CT78; DYS14; pJA923; TSPY"
/replace="c"
/replace="g"
/db_xref="dbSNP:1233759717"
variation 338
/gene="TSPY1"
/gene_synonym="CT78; DYS14; pJA923; TSPY"
/replace="c"
/replace="t"
/db_xref="dbSNP:1185795405"
variation 339
/gene="TSPY1"
/gene_synonym="CT78; DYS14; pJA923; TSPY"
/replace="c"
/replace="g"
/db_xref="dbSNP:1265245901"
variation 347
/gene="TSPY1"
/gene_synonym="CT78; DYS14; pJA923; TSPY"
/replace="a"
/replace="g"
/db_xref="dbSNP:1478212511"
variation 354
/gene="TSPY1"
/gene_synonym="CT78; DYS14; pJA923; TSPY"
/replace="a"
/replace="t"
/db_xref="dbSNP:1193013751"
variation 357
/gene="TSPY1"
/gene_synonym="CT78; DYS14; pJA923; TSPY"
/replace="a"
/replace="c"
/db_xref="dbSNP:1603142563"
variation 363
/gene="TSPY1"
/gene_synonym="CT78; DYS14; pJA923; TSPY"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:1421789884"
variation 366
/gene="TSPY1"
/gene_synonym="CT78; DYS14; pJA923; TSPY"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:1416340243"
variation 368
/gene="TSPY1"
/gene_synonym="CT78; DYS14; pJA923; TSPY"
/replace="g"
/replace="t"
/db_xref="dbSNP:1177249826"
variation 372
/gene="TSPY1"
/gene_synonym="CT78; DYS14; pJA923; TSPY"
/replace="c"
/replace="t"
/db_xref="dbSNP:1358889000"
variation 373
/gene="TSPY1"
/gene_synonym="CT78; DYS14; pJA923; TSPY"
/replace="a"
/replace="g"
/db_xref="dbSNP:1464846723"
variation 381
/gene="TSPY1"
/gene_synonym="CT78; DYS14; pJA923; TSPY"
/replace="a"
/replace="t"
/db_xref="dbSNP:777419549"
variation 382
/gene="TSPY1"
/gene_synonym="CT78; DYS14; pJA923; TSPY"
/replace="a"
/replace="g"
/db_xref="dbSNP:200389251"
variation 384
/gene="TSPY1"
/gene_synonym="CT78; DYS14; pJA923; TSPY"
/replace="a"
/replace="t"
/db_xref="dbSNP:1400128427"
variation 387..388
/gene="TSPY1"
/gene_synonym="CT78; DYS14; pJA923; TSPY"
/replace=""
/replace="cc"
/db_xref="dbSNP:771921825"
variation 387
/gene="TSPY1"
/gene_synonym="CT78; DYS14; pJA923; TSPY"
/replace="c"
/replace="t"
/db_xref="dbSNP:1276963055"
variation 388
/gene="TSPY1"
/gene_synonym="CT78; DYS14; pJA923; TSPY"
/replace="c"
/replace="g"
/db_xref="dbSNP:756779239"
variation 389
/gene="TSPY1"
/gene_synonym="CT78; DYS14; pJA923; TSPY"
/replace="a"
/replace="g"
/db_xref="dbSNP:781039925"
variation 390
/gene="TSPY1"
/gene_synonym="CT78; DYS14; pJA923; TSPY"
/replace="c"
/replace="t"
/db_xref="dbSNP:1220541090"
variation 394
/gene="TSPY1"
/gene_synonym="CT78; DYS14; pJA923; TSPY"
/replace="g"
/replace="t"
/db_xref="dbSNP:1278879967"
variation 398
/gene="TSPY1"
/gene_synonym="CT78; DYS14; pJA923; TSPY"
/replace="g"
/replace="t"
/db_xref="dbSNP:1311462417"
variation 400
/gene="TSPY1"
/gene_synonym="CT78; DYS14; pJA923; TSPY"
/replace="g"
/replace="t"
/db_xref="dbSNP:1208423297"
variation 401
/gene="TSPY1"
/gene_synonym="CT78; DYS14; pJA923; TSPY"
/replace="a"
/replace="c"
/db_xref="dbSNP:1288137239"
variation 406
/gene="TSPY1"
/gene_synonym="CT78; DYS14; pJA923; TSPY"
/replace="g"
/replace="t"
/db_xref="dbSNP:1488548781"
variation 407
/gene="TSPY1"
/gene_synonym="CT78; DYS14; pJA923; TSPY"
/replace="c"
/replace="t"
/db_xref="dbSNP:745768816"
variation 410
/gene="TSPY1"
/gene_synonym="CT78; DYS14; pJA923; TSPY"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:1240362123"
variation 411
/gene="TSPY1"
/gene_synonym="CT78; DYS14; pJA923; TSPY"
/replace="g"
/replace="t"
/db_xref="dbSNP:201424738"
variation 416
/gene="TSPY1"
/gene_synonym="CT78; DYS14; pJA923; TSPY"
/replace="c"
/replace="g"
/db_xref="dbSNP:1192052574"
variation 422
/gene="TSPY1"
/gene_synonym="CT78; DYS14; pJA923; TSPY"
/replace="g"
/replace="t"
/db_xref="dbSNP:775446628"
variation 425
/gene="TSPY1"
/gene_synonym="CT78; DYS14; pJA923; TSPY"
/replace="a"
/replace="c"
/db_xref="dbSNP:749030159"
variation 460
/gene="TSPY1"
/gene_synonym="CT78; DYS14; pJA923; TSPY"
/replace="a"
/replace="g"
/db_xref="dbSNP:1556182495"
variation 478
/gene="TSPY1"
/gene_synonym="CT78; DYS14; pJA923; TSPY"
/replace="c"
/replace="g"
/db_xref="dbSNP:772185599"
variation 485
/gene="TSPY1"
/gene_synonym="CT78; DYS14; pJA923; TSPY"
/replace="c"
/replace="t"
/db_xref="dbSNP:1556182525"
variation 496
/gene="TSPY1"
/gene_synonym="CT78; DYS14; pJA923; TSPY"
/replace="c"
/replace="g"
/db_xref="dbSNP:1603142681"
variation 497
/gene="TSPY1"
/gene_synonym="CT78; DYS14; pJA923; TSPY"
/replace="c"
/replace="g"
/db_xref="dbSNP:1431837856"
exon 533..610
/gene="TSPY1"
/gene_synonym="CT78; DYS14; pJA923; TSPY"
/inference="alignment:Splign:2.1.0"
variation 551
/gene="TSPY1"
/gene_synonym="CT78; DYS14; pJA923; TSPY"
/replace="a"
/replace="t"
/db_xref="dbSNP:1603142738"
exon 611..722
/gene="TSPY1"
/gene_synonym="CT78; DYS14; pJA923; TSPY"
/inference="alignment:Splign:2.1.0"
variation 615
/gene="TSPY1"
/gene_synonym="CT78; DYS14; pJA923; TSPY"
/replace="a"
/replace="g"
/db_xref="dbSNP:1297059542"
variation 616
/gene="TSPY1"
/gene_synonym="CT78; DYS14; pJA923; TSPY"
/replace="a"
/replace="t"
/db_xref="dbSNP:1342988681"
variation 618
/gene="TSPY1"
/gene_synonym="CT78; DYS14; pJA923; TSPY"
/replace="a"
/replace="c"
/db_xref="dbSNP:756757652"
variation 622
/gene="TSPY1"
/gene_synonym="CT78; DYS14; pJA923; TSPY"
/replace="g"
/replace="t"
/db_xref="dbSNP:780785122"
variation 625
/gene="TSPY1"
/gene_synonym="CT78; DYS14; pJA923; TSPY"
/replace="g"
/replace="t"
/db_xref="dbSNP:745321922"
variation 635
/gene="TSPY1"
/gene_synonym="CT78; DYS14; pJA923; TSPY"
/replace="a"
/replace="c"
/db_xref="dbSNP:756131625"
variation 637
/gene="TSPY1"
/gene_synonym="CT78; DYS14; pJA923; TSPY"
/replace="c"
/replace="t"
/db_xref="dbSNP:780067981"
variation 638
/gene="TSPY1"
/gene_synonym="CT78; DYS14; pJA923; TSPY"
/replace="c"
/replace="t"
/db_xref="dbSNP:1275117981"
variation 641
/gene="TSPY1"
/gene_synonym="CT78; DYS14; pJA923; TSPY"
/replace="c"
/replace="t"
/db_xref="dbSNP:1603142783"
variation 642
/gene="TSPY1"
/gene_synonym="CT78; DYS14; pJA923; TSPY"
/replace="g"
/replace="t"
/db_xref="dbSNP:749157835"
variation 644
/gene="TSPY1"
/gene_synonym="CT78; DYS14; pJA923; TSPY"
/replace="a"
/replace="g"
/db_xref="dbSNP:1366442282"
variation 649
/gene="TSPY1"
/gene_synonym="CT78; DYS14; pJA923; TSPY"
/replace="c"
/replace="g"
/db_xref="dbSNP:1603142795"
variation 653
/gene="TSPY1"
/gene_synonym="CT78; DYS14; pJA923; TSPY"
/replace="c"
/replace="t"
/db_xref="dbSNP:768481082"
variation 655
/gene="TSPY1"
/gene_synonym="CT78; DYS14; pJA923; TSPY"
/replace="a"
/replace="g"
/db_xref="dbSNP:773349562"
variation 662
/gene="TSPY1"
/gene_synonym="CT78; DYS14; pJA923; TSPY"
/replace="c"
/replace="t"
/db_xref="dbSNP:747291345"
variation 663
/gene="TSPY1"
/gene_synonym="CT78; DYS14; pJA923; TSPY"
/replace="a"
/replace="g"
/db_xref="dbSNP:771012234"
variation 669
/gene="TSPY1"
/gene_synonym="CT78; DYS14; pJA923; TSPY"
/replace="a"
/replace="g"
/db_xref="dbSNP:776707915"
variation 673
/gene="TSPY1"
/gene_synonym="CT78; DYS14; pJA923; TSPY"
/replace="c"
/replace="t"
/db_xref="dbSNP:759547669"
variation 681
/gene="TSPY1"
/gene_synonym="CT78; DYS14; pJA923; TSPY"
/replace="a"
/replace="g"
/db_xref="dbSNP:1231837592"
variation 688
/gene="TSPY1"
/gene_synonym="CT78; DYS14; pJA923; TSPY"
/replace="a"
/replace="g"
/db_xref="dbSNP:770355301"
variation 699
/gene="TSPY1"
/gene_synonym="CT78; DYS14; pJA923; TSPY"
/replace="a"
/replace="g"
/db_xref="dbSNP:1486450497"
exon 723..868
/gene="TSPY1"
/gene_synonym="CT78; DYS14; pJA923; TSPY"
/inference="alignment:Splign:2.1.0"
variation 732
/gene="TSPY1"
/gene_synonym="CT78; DYS14; pJA923; TSPY"
/replace="c"
/replace="t"
/db_xref="dbSNP:1215732327"
variation 757
/gene="TSPY1"
/gene_synonym="CT78; DYS14; pJA923; TSPY"
/replace="a"
/replace="g"
/db_xref="dbSNP:1556182856"
variation 762
/gene="TSPY1"
/gene_synonym="CT78; DYS14; pJA923; TSPY"
/replace="c"
/replace="t"
/db_xref="dbSNP:1603142842"
variation 781
/gene="TSPY1"
/gene_synonym="CT78; DYS14; pJA923; TSPY"
/replace="c"
/replace="g"
/db_xref="dbSNP:1282047748"
variation 785
/gene="TSPY1"
/gene_synonym="CT78; DYS14; pJA923; TSPY"
/replace="c"
/replace="t"
/db_xref="dbSNP:1453465763"
variation 788
/gene="TSPY1"
/gene_synonym="CT78; DYS14; pJA923; TSPY"
/replace="c"
/replace="t"
/db_xref="dbSNP:1363870448"
variation 804
/gene="TSPY1"
/gene_synonym="CT78; DYS14; pJA923; TSPY"
/replace="a"
/replace="g"
/db_xref="dbSNP:1246391705"
variation 845
/gene="TSPY1"
/gene_synonym="CT78; DYS14; pJA923; TSPY"
/replace="a"
/replace="g"
/db_xref="dbSNP:763277112"
variation 852
/gene="TSPY1"
/gene_synonym="CT78; DYS14; pJA923; TSPY"
/replace="c"
/replace="t"
/db_xref="dbSNP:1556182928"
exon 869..950
/gene="TSPY1"
/gene_synonym="CT78; DYS14; pJA923; TSPY"
/inference="alignment:Splign:2.1.0"
variation 883
/gene="TSPY1"
/gene_synonym="CT78; DYS14; pJA923; TSPY"
/replace="c"
/replace="t"
/db_xref="dbSNP:1603142880"
variation 890
/gene="TSPY1"
/gene_synonym="CT78; DYS14; pJA923; TSPY"
/replace="c"
/replace="t"
/db_xref="dbSNP:751830669"
variation 896
/gene="TSPY1"
/gene_synonym="CT78; DYS14; pJA923; TSPY"
/replace="a"
/replace="c"
/db_xref="dbSNP:761547400"
variation 899
/gene="TSPY1"
/gene_synonym="CT78; DYS14; pJA923; TSPY"
/replace="c"
/replace="g"
/db_xref="dbSNP:1333134024"
variation 906
/gene="TSPY1"
/gene_synonym="CT78; DYS14; pJA923; TSPY"
/replace="a"
/replace="c"
/db_xref="dbSNP:767219205"
variation 909
/gene="TSPY1"
/gene_synonym="CT78; DYS14; pJA923; TSPY"
/replace="a"
/replace="t"
/db_xref="dbSNP:1377437524"
variation 914
/gene="TSPY1"
/gene_synonym="CT78; DYS14; pJA923; TSPY"
/replace=""
/replace="a"
/db_xref="dbSNP:1239149611"
variation 926
/gene="TSPY1"
/gene_synonym="CT78; DYS14; pJA923; TSPY"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:1277739251"
variation 941
/gene="TSPY1"
/gene_synonym="CT78; DYS14; pJA923; TSPY"
/replace="c"
/replace="g"
/db_xref="dbSNP:1358351478"
variation 945
/gene="TSPY1"
/gene_synonym="CT78; DYS14; pJA923; TSPY"
/replace="c"
/replace="t"
/db_xref="dbSNP:1228984985"
variation 946
/gene="TSPY1"
/gene_synonym="CT78; DYS14; pJA923; TSPY"
/replace="a"
/replace="g"
/db_xref="dbSNP:749954093"
variation 948
/gene="TSPY1"
/gene_synonym="CT78; DYS14; pJA923; TSPY"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:1332965070"
exon 951..1161
/gene="TSPY1"
/gene_synonym="CT78; DYS14; pJA923; TSPY"
/inference="alignment:Splign:2.1.0"
variation 957
/gene="TSPY1"
/gene_synonym="CT78; DYS14; pJA923; TSPY"
/replace="c"
/replace="t"
/db_xref="dbSNP:771192571"
variation 1015
/gene="TSPY1"
/gene_synonym="CT78; DYS14; pJA923; TSPY"
/replace="c"
/replace="t"
/db_xref="dbSNP:1172453097"
variation 1019
/gene="TSPY1"
/gene_synonym="CT78; DYS14; pJA923; TSPY"
/replace="a"
/replace="g"
/db_xref="dbSNP:781388283"
variation 1061..1062
/gene="TSPY1"
/gene_synonym="CT78; DYS14; pJA923; TSPY"
/replace="tt"
/replace="ttt"
/db_xref="dbSNP:2124353821"
variation 1064
/gene="TSPY1"
/gene_synonym="CT78; DYS14; pJA923; TSPY"
/replace="c"
/replace="t"
/db_xref="dbSNP:1603143019"
variation 1086
/gene="TSPY1"
/gene_synonym="CT78; DYS14; pJA923; TSPY"
/replace="c"
/replace="g"
/db_xref="dbSNP:2124353832"
regulatory 1144..1149
/regulatory_class="polyA_signal_sequence"
/gene="TSPY1"
/gene_synonym="CT78; DYS14; pJA923; TSPY"
variation 1145
/gene="TSPY1"
/gene_synonym="CT78; DYS14; pJA923; TSPY"
/replace="a"
/replace="c"
/db_xref="dbSNP:1603143024"
variation 1155
/gene="TSPY1"
/gene_synonym="CT78; DYS14; pJA923; TSPY"
/replace="a"
/replace="t"
/db_xref="dbSNP:1603143026"
polyA_site 1161
/gene="TSPY1"
/gene_synonym="CT78; DYS14; pJA923; TSPY"
ORIGIN
ggcccttcgcgcgcagtcccttagggggcgcctggaagcccggcgcatgcgccctgagggctcgctgacctaccgggtgccagagaggctgcggcagggtttctgtggcgtgggtcgggcagcacaggccttggtgtgtgcgagtgccaaggagggcaccgccttcaggatggaggctgtgcaggagggggcggccggggtggagagtgagcaggcggctttgggggaggaggcggtgctgctgttggatgacataatggcggaggtggaggtggtggcggaggaggagggcctcgtggagcggcgggaggaggcccagcgggcacagcaggctgtgcctggccctgggcccatgaccccagagtctgcaccggaggagctgctggccgttcaggtggagctggagccggttaatgcccaagccaggaaggccttttctcggcagcgggaaaagatggagcggaggcgcaagccccacctagaccgcagaggcgccgtcatccagagcgtccctggcttctgggccaatgttattgcaaaccacccccagatgtcagccctgatcactgacgaagatgaagacatgctgagctacatggtcagcctggaggtgggagaagagaagcatcctgttcatctctgcaagatcatgttgttctttcggagtaacccctacttccagaataaagtgattaccaaggaatatctggtgaacatcacagaatacagggcttctcattccactccaattgagtggtatccggattatgaagtggaggcctatcgccgcagacaccacaacagcagccttaacttcttcaactggttctctgaccacaacttcgcaggatctaacaagattgctgagatcctatgtaaggacctgtggcgcaatcccctgcaatactacaagaggatgaagccacctgaagagggaacagagacgtcaggggactcccagttgttgagttgaatatgatggagcatcagattttacctaatacagcagaactcctaaaaagttacagccatatgcaggacggcagtactcagcatggtcttatgcacaggaactaaaggaaaaagagatcgagtcacaaaaattcaggaagagggggtaaatgtggattgtatggaatgaaaaataaacattctcaagga
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]