GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-04-30 22:15:59, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       NM_003308               1161 bp    mRNA    linear   PRI 25-MAR-2023
DEFINITION  Homo sapiens testis specific protein Y-linked 1 (TSPY1), transcript
            variant 1, mRNA.
ACCESSION   NM_003308
VERSION     NM_003308.4
KEYWORDS    RefSeq; MANE Select.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1161)
  AUTHORS   Paladhi P, Dutta S, Pal S, Bose G, Ghosh P, Chattopadhyay R,
            Chakravarty B, Saha I and Ghosh S.
  TITLE     Novel Mutations of TSPY1 Gene Associate Spermatogenic Failure Among
            Men
  JOURNAL   Reprod Sci 29 (4), 1241-1261 (2022)
   PUBMED   35041134
  REMARK    GeneRIF: Novel Mutations of TSPY1 Gene Associate Spermatogenic
            Failure Among Men.
REFERENCE   2  (bases 1 to 1161)
  AUTHORS   Leng X, Liu M, Tao D, Yang B, Zhang Y, He T, Xie S, Wang Z, Liu Y
            and Yang Y.
  TITLE     Epigenetic modification-dependent androgen receptor occupancy
            facilitates the ectopic TSPY1 expression in prostate cancer cells
  JOURNAL   Cancer Sci 112 (2), 691-702 (2021)
   PUBMED   33185915
  REMARK    GeneRIF: Epigenetic modification-dependent androgen receptor
            occupancy facilitates the ectopic TSPY1 expression in prostate
            cancer cells.
REFERENCE   3  (bases 1 to 1161)
  AUTHORS   Giguere K, Leblond FA, Goma-Matsetse E, Dave V, Behanzin L, Guedou
            FA and Alary M.
  TITLE     A novel nested polymerase chain reaction targeting the
            testis-specific protein Y-encoded family of genes for high
            sensitivity of recent semen exposure detection: Comparison with
            four other assays of semen detection
  JOURNAL   PLoS One 14 (7), e0220326 (2019)
   PUBMED   31344101
  REMARK    GeneRIF: Compared to n-TSPY, all other PCR assays had poor
            performance to detect semen exposure. The n-TSPY is an accessible
            assay that may have great utility in assessing semen exposure in
            studies where many factors are expected to accelerate biomarkers'
            clearance.
            Publication Status: Online-Only
REFERENCE   4  (bases 1 to 1161)
  AUTHORS   Tu W, Yang B, Leng X, Pei X, Xu J, Liu M, Dong Q, Tao D, Lu Y, Liu
            Y and Yang Y.
  TITLE     Testis-specific protein, Y-linked 1 activates PI3K/AKT and RAS
            signaling pathways through suppressing IGFBP3 expression during
            tumor progression
  JOURNAL   Cancer Sci 110 (5), 1573-1586 (2019)
   PUBMED   30815935
  REMARK    GeneRIF: Experimental evidence establishes TSPY1 as an oncogenic
            factor that facilitates tumor progression and causes poor prognosis
            in male patients with lung adenocarcinoma or hepatocellular
            carcinoma. These findings revealed that TSPY1 strongly promotes the
            activation of the PI3K/AKT and RAS signaling pathways through
            suppressing IGFBP3 gene transcription.
REFERENCE   5  (bases 1 to 1161)
  AUTHORS   Xue Y and Tyler-Smith C.
  TITLE     An Exceptional Gene: Evolution of the TSPY Gene Family in Humans
            and Other Great Apes
  JOURNAL   Genes (Basel) 2 (1), 36-47 (2011)
   PUBMED   24710137
  REMARK    Publication Status: Online-Only
REFERENCE   6  (bases 1 to 1161)
  AUTHORS   Krick R, Jakubiczka S and Arnemann J.
  TITLE     Expression, alternative splicing and haplotype analysis of
            transcribed testis specific protein (TSPY) genes
  JOURNAL   Gene 302 (1-2), 11-19 (2003)
   PUBMED   12527192
REFERENCE   7  (bases 1 to 1161)
  AUTHORS   Zhang JS, Yang-Feng TL, Muller U, Mohandas TK, de Jong PJ and Lau
            YF.
  TITLE     Molecular isolation and characterization of an expressed gene from
            the human Y chromosome
  JOURNAL   Hum Mol Genet 1 (9), 717-726 (1992)
   PUBMED   1284595
REFERENCE   8  (bases 1 to 1161)
  AUTHORS   Guttenbach M, Muller U and Schmid M.
  TITLE     A human moderately repeated Y-specific DNA sequence is
            evolutionarily conserved in the Y chromosome of the great apes
  JOURNAL   Genomics 13 (2), 363-367 (1992)
   PUBMED   1612595
REFERENCE   9  (bases 1 to 1161)
  AUTHORS   Arnemann J, Jakubiczka S, Thuring S and Schmidtke J.
  TITLE     Cloning and sequence analysis of a human Y-chromosome-derived,
            testicular cDNA, TSPY
  JOURNAL   Genomics 11 (1), 108-114 (1991)
   PUBMED   1765369
REFERENCE   10 (bases 1 to 1161)
  AUTHORS   Arnemann J, Epplen JT, Cooke HJ, Sauermann U, Engel W and Schmidtke
            J.
  TITLE     A human Y-chromosomal DNA sequence expressed in testicular tissue
  JOURNAL   Nucleic Acids Res 15 (21), 8713-8724 (1987)
   PUBMED   3479749
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from AC006156.5.
            This sequence is a reference standard in the RefSeqGene project.
            
            On Mar 10, 2016 this sequence version replaced NM_003308.3.
            
            Summary: The protein encoded by this gene is found only in
            testicular tissue and may be involved in spermatogenesis. Many
            functional paralogs and pseudogenes of this gene are present in a
            cluster in humans, but only a single, nonfunctional orthologous
            gene is found in mouse. Alternative splicing results in multiple
            transcript variants. [provided by RefSeq, Mar 2016].
            
            Transcript Variant: This variant (1) encodes the longer isoform
            (TSPY-S).
            
            Sequence Note: The RefSeq transcript and protein were derived from
            genomic sequence to make the sequence consistent with the reference
            genome assembly. The genomic coordinates used for the transcript
            record were based on alignments.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            RNAseq introns :: single sample supports all introns SAMEA1968968,
                              SAMEA2148093 [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            MANE Ensembl match     :: ENST00000451548.6/ ENSP00000403304.1
            RefSeq Select criteria :: based on conservation, expression
            ##RefSeq-Attributes-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-532               AC006156.5         13242-13773
            533-610             AC006156.5         14381-14458
            611-722             AC006156.5         14587-14698
            723-868             AC006156.5         14800-14945
            869-950             AC006156.5         15052-15133
            951-1161            AC006156.5         15826-16036
FEATURES             Location/Qualifiers
     source          1..1161
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="Y"
                     /map="Yp11.2"
     gene            1..1161
                     /gene="TSPY1"
                     /gene_synonym="CT78; DYS14; pJA923; TSPY"
                     /note="testis specific protein Y-linked 1"
                     /db_xref="GeneID:7258"
                     /db_xref="HGNC:HGNC:12381"
                     /db_xref="MIM:480100"
     exon            1..532
                     /gene="TSPY1"
                     /gene_synonym="CT78; DYS14; pJA923; TSPY"
                     /inference="alignment:Splign:2.1.0"
     variation       8
                     /gene="TSPY1"
                     /gene_synonym="CT78; DYS14; pJA923; TSPY"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1556182097"
     variation       17
                     /gene="TSPY1"
                     /gene_synonym="CT78; DYS14; pJA923; TSPY"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1603142441"
     variation       21
                     /gene="TSPY1"
                     /gene_synonym="CT78; DYS14; pJA923; TSPY"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1379118618"
     variation       22
                     /gene="TSPY1"
                     /gene_synonym="CT78; DYS14; pJA923; TSPY"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1603142449"
     variation       29
                     /gene="TSPY1"
                     /gene_synonym="CT78; DYS14; pJA923; TSPY"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1394730875"
     variation       30
                     /gene="TSPY1"
                     /gene_synonym="CT78; DYS14; pJA923; TSPY"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1603142459"
     variation       38
                     /gene="TSPY1"
                     /gene_synonym="CT78; DYS14; pJA923; TSPY"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1290917158"
     CDS             47..973
                     /gene="TSPY1"
                     /gene_synonym="CT78; DYS14; pJA923; TSPY"
                     /note="isoform TSPY-S is encoded by transcript variant 1;
                     cancer/testis antigen 78; testis-specific Y-encoded
                     protein 1; testis specific protein, Y-linked"
                     /codon_start=1
                     /product="testis-specific Y-encoded protein 1 isoform
                     TSPY-S"
                     /protein_id="NP_003299.2"
                     /db_xref="CCDS:CCDS48205.1"
                     /db_xref="GeneID:7258"
                     /db_xref="HGNC:HGNC:12381"
                     /db_xref="MIM:480100"
                     /translation="
MRPEGSLTYRVPERLRQGFCGVGRAAQALVCASAKEGTAFRMEAVQEGAAGVESEQAALGEEAVLLLDDIMAEVEVVAEEEGLVERREEAQRAQQAVPGPGPMTPESAPEELLAVQVELEPVNAQARKAFSRQREKMERRRKPHLDRRGAVIQSVPGFWANVIANHPQMSALITDEDEDMLSYMVSLEVGEEKHPVHLCKIMLFFRSNPYFQNKVITKEYLVNITEYRASHSTPIEWYPDYEVEAYRRRHHNSSLNFFNWFSDHNFAGSNKIAEILCKDLWRNPLQYYKRMKPPEEGTETSGDSQLLS"
     misc_feature    422..910
                     /gene="TSPY1"
                     /gene_synonym="CT78; DYS14; pJA923; TSPY"
                     /note="Nucleosome assembly protein (NAP); Region: NAP;
                     cl08298"
                     /db_xref="CDD:447601"
     variation       58
                     /gene="TSPY1"
                     /gene_synonym="CT78; DYS14; pJA923; TSPY"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1603142470"
     variation       60
                     /gene="TSPY1"
                     /gene_synonym="CT78; DYS14; pJA923; TSPY"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1556182135"
     variation       67
                     /gene="TSPY1"
                     /gene_synonym="CT78; DYS14; pJA923; TSPY"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1603142485"
     variation       73
                     /gene="TSPY1"
                     /gene_synonym="CT78; DYS14; pJA923; TSPY"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:754351883"
     variation       85
                     /gene="TSPY1"
                     /gene_synonym="CT78; DYS14; pJA923; TSPY"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1603142497"
     variation       179
                     /gene="TSPY1"
                     /gene_synonym="CT78; DYS14; pJA923; TSPY"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:2124352953"
     variation       181
                     /gene="TSPY1"
                     /gene_synonym="CT78; DYS14; pJA923; TSPY"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1218701068"
     variation       187..191
                     /gene="TSPY1"
                     /gene_synonym="CT78; DYS14; pJA923; TSPY"
                     /replace="gggg"
                     /replace="ggggg"
                     /db_xref="dbSNP:1257071390"
     variation       194
                     /gene="TSPY1"
                     /gene_synonym="CT78; DYS14; pJA923; TSPY"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1603142511"
     variation       258
                     /gene="TSPY1"
                     /gene_synonym="CT78; DYS14; pJA923; TSPY"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:2016041408"
     variation       268
                     /gene="TSPY1"
                     /gene_synonym="CT78; DYS14; pJA923; TSPY"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1305374581"
     variation       276
                     /gene="TSPY1"
                     /gene_synonym="CT78; DYS14; pJA923; TSPY"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:2016041540"
     variation       290
                     /gene="TSPY1"
                     /gene_synonym="CT78; DYS14; pJA923; TSPY"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1603142522"
     variation       298
                     /gene="TSPY1"
                     /gene_synonym="CT78; DYS14; pJA923; TSPY"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1211999813"
     variation       303
                     /gene="TSPY1"
                     /gene_synonym="CT78; DYS14; pJA923; TSPY"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:777840135"
     variation       306..308
                     /gene="TSPY1"
                     /gene_synonym="CT78; DYS14; pJA923; TSPY"
                     /replace="ggg"
                     /replace="gggg"
                     /db_xref="dbSNP:2124353015"
     variation       311
                     /gene="TSPY1"
                     /gene_synonym="CT78; DYS14; pJA923; TSPY"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1482895379"
     variation       314
                     /gene="TSPY1"
                     /gene_synonym="CT78; DYS14; pJA923; TSPY"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:765624506"
     variation       315
                     /gene="TSPY1"
                     /gene_synonym="CT78; DYS14; pJA923; TSPY"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:753013820"
     variation       321
                     /gene="TSPY1"
                     /gene_synonym="CT78; DYS14; pJA923; TSPY"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:758060583"
     variation       335
                     /gene="TSPY1"
                     /gene_synonym="CT78; DYS14; pJA923; TSPY"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1233759717"
     variation       338
                     /gene="TSPY1"
                     /gene_synonym="CT78; DYS14; pJA923; TSPY"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1185795405"
     variation       339
                     /gene="TSPY1"
                     /gene_synonym="CT78; DYS14; pJA923; TSPY"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1265245901"
     variation       347
                     /gene="TSPY1"
                     /gene_synonym="CT78; DYS14; pJA923; TSPY"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1478212511"
     variation       354
                     /gene="TSPY1"
                     /gene_synonym="CT78; DYS14; pJA923; TSPY"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1193013751"
     variation       357
                     /gene="TSPY1"
                     /gene_synonym="CT78; DYS14; pJA923; TSPY"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1603142563"
     variation       363
                     /gene="TSPY1"
                     /gene_synonym="CT78; DYS14; pJA923; TSPY"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1421789884"
     variation       366
                     /gene="TSPY1"
                     /gene_synonym="CT78; DYS14; pJA923; TSPY"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1416340243"
     variation       368
                     /gene="TSPY1"
                     /gene_synonym="CT78; DYS14; pJA923; TSPY"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1177249826"
     variation       372
                     /gene="TSPY1"
                     /gene_synonym="CT78; DYS14; pJA923; TSPY"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1358889000"
     variation       373
                     /gene="TSPY1"
                     /gene_synonym="CT78; DYS14; pJA923; TSPY"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1464846723"
     variation       381
                     /gene="TSPY1"
                     /gene_synonym="CT78; DYS14; pJA923; TSPY"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:777419549"
     variation       382
                     /gene="TSPY1"
                     /gene_synonym="CT78; DYS14; pJA923; TSPY"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:200389251"
     variation       384
                     /gene="TSPY1"
                     /gene_synonym="CT78; DYS14; pJA923; TSPY"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1400128427"
     variation       387..388
                     /gene="TSPY1"
                     /gene_synonym="CT78; DYS14; pJA923; TSPY"
                     /replace=""
                     /replace="cc"
                     /db_xref="dbSNP:771921825"
     variation       387
                     /gene="TSPY1"
                     /gene_synonym="CT78; DYS14; pJA923; TSPY"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1276963055"
     variation       388
                     /gene="TSPY1"
                     /gene_synonym="CT78; DYS14; pJA923; TSPY"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:756779239"
     variation       389
                     /gene="TSPY1"
                     /gene_synonym="CT78; DYS14; pJA923; TSPY"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:781039925"
     variation       390
                     /gene="TSPY1"
                     /gene_synonym="CT78; DYS14; pJA923; TSPY"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1220541090"
     variation       394
                     /gene="TSPY1"
                     /gene_synonym="CT78; DYS14; pJA923; TSPY"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1278879967"
     variation       398
                     /gene="TSPY1"
                     /gene_synonym="CT78; DYS14; pJA923; TSPY"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1311462417"
     variation       400
                     /gene="TSPY1"
                     /gene_synonym="CT78; DYS14; pJA923; TSPY"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1208423297"
     variation       401
                     /gene="TSPY1"
                     /gene_synonym="CT78; DYS14; pJA923; TSPY"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1288137239"
     variation       406
                     /gene="TSPY1"
                     /gene_synonym="CT78; DYS14; pJA923; TSPY"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1488548781"
     variation       407
                     /gene="TSPY1"
                     /gene_synonym="CT78; DYS14; pJA923; TSPY"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:745768816"
     variation       410
                     /gene="TSPY1"
                     /gene_synonym="CT78; DYS14; pJA923; TSPY"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1240362123"
     variation       411
                     /gene="TSPY1"
                     /gene_synonym="CT78; DYS14; pJA923; TSPY"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:201424738"
     variation       416
                     /gene="TSPY1"
                     /gene_synonym="CT78; DYS14; pJA923; TSPY"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1192052574"
     variation       422
                     /gene="TSPY1"
                     /gene_synonym="CT78; DYS14; pJA923; TSPY"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:775446628"
     variation       425
                     /gene="TSPY1"
                     /gene_synonym="CT78; DYS14; pJA923; TSPY"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:749030159"
     variation       460
                     /gene="TSPY1"
                     /gene_synonym="CT78; DYS14; pJA923; TSPY"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1556182495"
     variation       478
                     /gene="TSPY1"
                     /gene_synonym="CT78; DYS14; pJA923; TSPY"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:772185599"
     variation       485
                     /gene="TSPY1"
                     /gene_synonym="CT78; DYS14; pJA923; TSPY"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1556182525"
     variation       496
                     /gene="TSPY1"
                     /gene_synonym="CT78; DYS14; pJA923; TSPY"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1603142681"
     variation       497
                     /gene="TSPY1"
                     /gene_synonym="CT78; DYS14; pJA923; TSPY"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1431837856"
     exon            533..610
                     /gene="TSPY1"
                     /gene_synonym="CT78; DYS14; pJA923; TSPY"
                     /inference="alignment:Splign:2.1.0"
     variation       551
                     /gene="TSPY1"
                     /gene_synonym="CT78; DYS14; pJA923; TSPY"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1603142738"
     exon            611..722
                     /gene="TSPY1"
                     /gene_synonym="CT78; DYS14; pJA923; TSPY"
                     /inference="alignment:Splign:2.1.0"
     variation       615
                     /gene="TSPY1"
                     /gene_synonym="CT78; DYS14; pJA923; TSPY"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1297059542"
     variation       616
                     /gene="TSPY1"
                     /gene_synonym="CT78; DYS14; pJA923; TSPY"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1342988681"
     variation       618
                     /gene="TSPY1"
                     /gene_synonym="CT78; DYS14; pJA923; TSPY"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:756757652"
     variation       622
                     /gene="TSPY1"
                     /gene_synonym="CT78; DYS14; pJA923; TSPY"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:780785122"
     variation       625
                     /gene="TSPY1"
                     /gene_synonym="CT78; DYS14; pJA923; TSPY"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:745321922"
     variation       635
                     /gene="TSPY1"
                     /gene_synonym="CT78; DYS14; pJA923; TSPY"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:756131625"
     variation       637
                     /gene="TSPY1"
                     /gene_synonym="CT78; DYS14; pJA923; TSPY"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:780067981"
     variation       638
                     /gene="TSPY1"
                     /gene_synonym="CT78; DYS14; pJA923; TSPY"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1275117981"
     variation       641
                     /gene="TSPY1"
                     /gene_synonym="CT78; DYS14; pJA923; TSPY"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1603142783"
     variation       642
                     /gene="TSPY1"
                     /gene_synonym="CT78; DYS14; pJA923; TSPY"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:749157835"
     variation       644
                     /gene="TSPY1"
                     /gene_synonym="CT78; DYS14; pJA923; TSPY"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1366442282"
     variation       649
                     /gene="TSPY1"
                     /gene_synonym="CT78; DYS14; pJA923; TSPY"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1603142795"
     variation       653
                     /gene="TSPY1"
                     /gene_synonym="CT78; DYS14; pJA923; TSPY"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:768481082"
     variation       655
                     /gene="TSPY1"
                     /gene_synonym="CT78; DYS14; pJA923; TSPY"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:773349562"
     variation       662
                     /gene="TSPY1"
                     /gene_synonym="CT78; DYS14; pJA923; TSPY"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:747291345"
     variation       663
                     /gene="TSPY1"
                     /gene_synonym="CT78; DYS14; pJA923; TSPY"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:771012234"
     variation       669
                     /gene="TSPY1"
                     /gene_synonym="CT78; DYS14; pJA923; TSPY"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:776707915"
     variation       673
                     /gene="TSPY1"
                     /gene_synonym="CT78; DYS14; pJA923; TSPY"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:759547669"
     variation       681
                     /gene="TSPY1"
                     /gene_synonym="CT78; DYS14; pJA923; TSPY"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1231837592"
     variation       688
                     /gene="TSPY1"
                     /gene_synonym="CT78; DYS14; pJA923; TSPY"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:770355301"
     variation       699
                     /gene="TSPY1"
                     /gene_synonym="CT78; DYS14; pJA923; TSPY"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1486450497"
     exon            723..868
                     /gene="TSPY1"
                     /gene_synonym="CT78; DYS14; pJA923; TSPY"
                     /inference="alignment:Splign:2.1.0"
     variation       732
                     /gene="TSPY1"
                     /gene_synonym="CT78; DYS14; pJA923; TSPY"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1215732327"
     variation       757
                     /gene="TSPY1"
                     /gene_synonym="CT78; DYS14; pJA923; TSPY"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1556182856"
     variation       762
                     /gene="TSPY1"
                     /gene_synonym="CT78; DYS14; pJA923; TSPY"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1603142842"
     variation       781
                     /gene="TSPY1"
                     /gene_synonym="CT78; DYS14; pJA923; TSPY"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1282047748"
     variation       785
                     /gene="TSPY1"
                     /gene_synonym="CT78; DYS14; pJA923; TSPY"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1453465763"
     variation       788
                     /gene="TSPY1"
                     /gene_synonym="CT78; DYS14; pJA923; TSPY"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1363870448"
     variation       804
                     /gene="TSPY1"
                     /gene_synonym="CT78; DYS14; pJA923; TSPY"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1246391705"
     variation       845
                     /gene="TSPY1"
                     /gene_synonym="CT78; DYS14; pJA923; TSPY"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:763277112"
     variation       852
                     /gene="TSPY1"
                     /gene_synonym="CT78; DYS14; pJA923; TSPY"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1556182928"
     exon            869..950
                     /gene="TSPY1"
                     /gene_synonym="CT78; DYS14; pJA923; TSPY"
                     /inference="alignment:Splign:2.1.0"
     variation       883
                     /gene="TSPY1"
                     /gene_synonym="CT78; DYS14; pJA923; TSPY"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1603142880"
     variation       890
                     /gene="TSPY1"
                     /gene_synonym="CT78; DYS14; pJA923; TSPY"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:751830669"
     variation       896
                     /gene="TSPY1"
                     /gene_synonym="CT78; DYS14; pJA923; TSPY"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:761547400"
     variation       899
                     /gene="TSPY1"
                     /gene_synonym="CT78; DYS14; pJA923; TSPY"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1333134024"
     variation       906
                     /gene="TSPY1"
                     /gene_synonym="CT78; DYS14; pJA923; TSPY"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:767219205"
     variation       909
                     /gene="TSPY1"
                     /gene_synonym="CT78; DYS14; pJA923; TSPY"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1377437524"
     variation       914
                     /gene="TSPY1"
                     /gene_synonym="CT78; DYS14; pJA923; TSPY"
                     /replace=""
                     /replace="a"
                     /db_xref="dbSNP:1239149611"
     variation       926
                     /gene="TSPY1"
                     /gene_synonym="CT78; DYS14; pJA923; TSPY"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1277739251"
     variation       941
                     /gene="TSPY1"
                     /gene_synonym="CT78; DYS14; pJA923; TSPY"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1358351478"
     variation       945
                     /gene="TSPY1"
                     /gene_synonym="CT78; DYS14; pJA923; TSPY"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1228984985"
     variation       946
                     /gene="TSPY1"
                     /gene_synonym="CT78; DYS14; pJA923; TSPY"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:749954093"
     variation       948
                     /gene="TSPY1"
                     /gene_synonym="CT78; DYS14; pJA923; TSPY"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1332965070"
     exon            951..1161
                     /gene="TSPY1"
                     /gene_synonym="CT78; DYS14; pJA923; TSPY"
                     /inference="alignment:Splign:2.1.0"
     variation       957
                     /gene="TSPY1"
                     /gene_synonym="CT78; DYS14; pJA923; TSPY"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:771192571"
     variation       1015
                     /gene="TSPY1"
                     /gene_synonym="CT78; DYS14; pJA923; TSPY"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1172453097"
     variation       1019
                     /gene="TSPY1"
                     /gene_synonym="CT78; DYS14; pJA923; TSPY"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:781388283"
     variation       1061..1062
                     /gene="TSPY1"
                     /gene_synonym="CT78; DYS14; pJA923; TSPY"
                     /replace="tt"
                     /replace="ttt"
                     /db_xref="dbSNP:2124353821"
     variation       1064
                     /gene="TSPY1"
                     /gene_synonym="CT78; DYS14; pJA923; TSPY"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1603143019"
     variation       1086
                     /gene="TSPY1"
                     /gene_synonym="CT78; DYS14; pJA923; TSPY"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:2124353832"
     regulatory      1144..1149
                     /regulatory_class="polyA_signal_sequence"
                     /gene="TSPY1"
                     /gene_synonym="CT78; DYS14; pJA923; TSPY"
     variation       1145
                     /gene="TSPY1"
                     /gene_synonym="CT78; DYS14; pJA923; TSPY"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1603143024"
     variation       1155
                     /gene="TSPY1"
                     /gene_synonym="CT78; DYS14; pJA923; TSPY"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1603143026"
     polyA_site      1161
                     /gene="TSPY1"
                     /gene_synonym="CT78; DYS14; pJA923; TSPY"
ORIGIN      
ggcccttcgcgcgcagtcccttagggggcgcctggaagcccggcgcatgcgccctgagggctcgctgacctaccgggtgccagagaggctgcggcagggtttctgtggcgtgggtcgggcagcacaggccttggtgtgtgcgagtgccaaggagggcaccgccttcaggatggaggctgtgcaggagggggcggccggggtggagagtgagcaggcggctttgggggaggaggcggtgctgctgttggatgacataatggcggaggtggaggtggtggcggaggaggagggcctcgtggagcggcgggaggaggcccagcgggcacagcaggctgtgcctggccctgggcccatgaccccagagtctgcaccggaggagctgctggccgttcaggtggagctggagccggttaatgcccaagccaggaaggccttttctcggcagcgggaaaagatggagcggaggcgcaagccccacctagaccgcagaggcgccgtcatccagagcgtccctggcttctgggccaatgttattgcaaaccacccccagatgtcagccctgatcactgacgaagatgaagacatgctgagctacatggtcagcctggaggtgggagaagagaagcatcctgttcatctctgcaagatcatgttgttctttcggagtaacccctacttccagaataaagtgattaccaaggaatatctggtgaacatcacagaatacagggcttctcattccactccaattgagtggtatccggattatgaagtggaggcctatcgccgcagacaccacaacagcagccttaacttcttcaactggttctctgaccacaacttcgcaggatctaacaagattgctgagatcctatgtaaggacctgtggcgcaatcccctgcaatactacaagaggatgaagccacctgaagagggaacagagacgtcaggggactcccagttgttgagttgaatatgatggagcatcagattttacctaatacagcagaactcctaaaaagttacagccatatgcaggacggcagtactcagcatggtcttatgcacaggaactaaaggaaaaagagatcgagtcacaaaaattcaggaagagggggtaaatgtggattgtatggaatgaaaaataaacattctcaagga
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]