LOCUS       NM_001411001            2018 bp    mRNA    linear   PRI 01-JAN-2023
DEFINITION  Homo sapiens nucleoporin 58 (NUP58), transcript variant 3, mRNA.
ACCESSION   NM_001411001 XM_011535328
VERSION     NM_001411001.1
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 2018)
  AUTHORS   Targa A, Larrimore KE, Wong CK, Chong YL, Fung R, Lee J, Choi H and
            Rancati G.
  TITLE     Non-genetic and genetic rewiring underlie adaptation to hypomorphic
            alleles of an essential gene
  JOURNAL   EMBO J 40 (21), e107839 (2021)
   PUBMED   34528284
  REMARK    GeneRIF: Non-genetic and genetic rewiring underlie adaptation to
            hypomorphic alleles of an essential gene.
REFERENCE   2  (bases 1 to 2018)
  AUTHORS   Haenig C, Atias N, Taylor AK, Mazza A, Schaefer MH, Russ J,
            Riechers SP, Jain S, Coughlin M, Fontaine JF, Freibaum BD,
            Brusendorf L, Zenkner M, Porras P, Stroedicke M, Schnoegl S,
            Arnsburg K, Boeddrich A, Pigazzini L, Heutink P, Taylor JP,
            Kirstein J, Andrade-Navarro MA, Sharan R and Wanker EE.
  TITLE     Interactome Mapping Provides a Network of Neurodegenerative Disease
            Proteins and Uncovers Widespread Protein Aggregation in Affected
            Brains
  JOURNAL   Cell Rep 32 (7), 108050 (2020)
   PUBMED   32814053
REFERENCE   3  (bases 1 to 2018)
  AUTHORS   Luck K, Kim DK, Lambourne L, Spirohn K, Begg BE, Bian W, Brignall
            R, Cafarelli T, Campos-Laborie FJ, Charloteaux B, Choi D, Cote AG,
            Daley M, Deimling S, Desbuleux A, Dricot A, Gebbia M, Hardy MF,
            Kishore N, Knapp JJ, Kovacs IA, Lemmens I, Mee MW, Mellor JC,
            Pollis C, Pons C, Richardson AD, Schlabach S, Teeking B, Yadav A,
            Babor M, Balcha D, Basha O, Bowman-Colin C, Chin SF, Choi SG,
            Colabella C, Coppin G, D'Amata C, De Ridder D, De Rouck S,
            Duran-Frigola M, Ennajdaoui H, Goebels F, Goehring L, Gopal A,
            Haddad G, Hatchi E, Helmy M, Jacob Y, Kassa Y, Landini S, Li R, van
            Lieshout N, MacWilliams A, Markey D, Paulson JN, Rangarajan S,
            Rasla J, Rayhan A, Rolland T, San-Miguel A, Shen Y, Sheykhkarimli
            D, Sheynkman GM, Simonovsky E, Tasan M, Tejeda A, Tropepe V,
            Twizere JC, Wang Y, Weatheritt RJ, Weile J, Xia Y, Yang X,
            Yeger-Lotem E, Zhong Q, Aloy P, Bader GD, De Las Rivas J, Gaudet S,
            Hao T, Rak J, Tavernier J, Hill DE, Vidal M, Roth FP and Calderwood
            MA.
  TITLE     A reference map of the human binary protein interactome
  JOURNAL   Nature 580 (7803), 402-408 (2020)
   PUBMED   32296183
REFERENCE   4  (bases 1 to 2018)
  AUTHORS   Fragoza R, Das J, Wierbowski SD, Liang J, Tran TN, Liang S, Beltran
            JF, Rivera-Erick CA, Ye K, Wang TY, Yao L, Mort M, Stenson PD,
            Cooper DN, Wei X, Keinan A, Schimenti JC, Clark AG and Yu H.
  TITLE     Extensive disruption of protein interactions by genetic variants
            across the allele frequency spectrum in human populations
  JOURNAL   Nat Commun 10 (1), 4141 (2019)
   PUBMED   31515488
  REMARK    Publication Status: Online-Only
REFERENCE   5  (bases 1 to 2018)
  AUTHORS   Fasci D, van Ingen H, Scheltema RA and Heck AJR.
  TITLE     Histone Interaction Landscapes Visualized by Crosslinking Mass
            Spectrometry in Intact Cell Nuclei
  JOURNAL   Mol Cell Proteomics 17 (10), 2018-2033 (2018)
   PUBMED   30021884
REFERENCE   6  (bases 1 to 2018)
  AUTHORS   Kaltenbach LS, Romero E, Becklin RR, Chettier R, Bell R, Phansalkar
            A, Strand A, Torcassi C, Savage J, Hurlburt A, Cha GH, Ukani L,
            Chepanoske CL, Zhen Y, Sahasrabudhe S, Olson J, Kurschner C,
            Ellerby LM, Peltier JM, Botas J and Hughes RE.
  TITLE     Huntingtin interacting proteins are genetic modifiers of
            neurodegeneration
  JOURNAL   PLoS Genet 3 (5), e82 (2007)
   PUBMED   17500595
REFERENCE   7  (bases 1 to 2018)
  AUTHORS   Le Rouzic E, Mousnier A, Rustum C, Stutz F, Hallberg E, Dargemont C
            and Benichou S.
  TITLE     Docking of HIV-1 Vpr to the nuclear envelope is mediated by the
            interaction with the nucleoporin hCG1
  JOURNAL   J Biol Chem 277 (47), 45091-45098 (2002)
   PUBMED   12228227
REFERENCE   8  (bases 1 to 2018)
  AUTHORS   Ben-Efraim I and Gerace L.
  TITLE     Gradient of increasing affinity of importin beta for nucleoporins
            along the pathway of nuclear import
  JOURNAL   J Cell Biol 152 (2), 411-417 (2001)
   PUBMED   11266456
REFERENCE   9  (bases 1 to 2018)
  AUTHORS   Shiota C, Coffey J, Grimsby J, Grippo JF and Magnuson MA.
  TITLE     Nuclear import of hepatic glucokinase depends upon glucokinase
            regulatory protein, whereas export is due to a nuclear export
            signal sequence in glucokinase
  JOURNAL   J Biol Chem 274 (52), 37125-37130 (1999)
   PUBMED   10601273
REFERENCE   10 (bases 1 to 2018)
  AUTHORS   Buss F and Stewart M.
  TITLE     Macromolecular interactions in the nucleoporin p62 complex of rat
            nuclear pores: binding of nucleoporin p54 to the rod domain of p62
  JOURNAL   J Cell Biol 128 (3), 251-261 (1995)
   PUBMED   7531196
  REMARK    GeneRIF: The human gene NUPL1 shares 87% sequence identity with rat
            nucleoporin p58.
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from AL590787.24, AL646102.4 and
            AL138958.18.
            
            On Aug 20, 2022 this sequence version replaced XM_011535328.3.
            
            Summary: This gene encodes a member of the nucleoporin family that
            shares 87% sequence identity with rat nucleoporin p58. The protein
            is localized to the nuclear rim and is a component of the nuclear
            pore complex (NPC). All molecules entering or leaving the nucleus
            either diffuse through or are actively transported by the NPC.
            Alternate transcriptional splice variants, encoding different
            isoforms, have been characterized. [provided by RefSeq, Jul 2008].
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: SRR5189667.370200.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA1968968, SAMEA2148093
                                           [ECO:0000348]
            ##Evidence-Data-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-256               AL590787.24        86900-87155
            257-399             AL590787.24        93081-93223
            400-435             AL590787.24        94522-94557
            436-585             AL590787.24        98158-98307
            586-723             AL590787.24        98889-99026
            724-834             AL590787.24        100632-100742
            835-859             AL590787.24        104601-104625
            860-925             AL590787.24        105805-105870
            926-1100            AL590787.24        106194-106368
            1101-1180           AL590787.24        110264-110343
            1181-1299           AL590787.24        112191-112309
            1300-1382           AL590787.24        112705-112787
            1383-1584           AL590787.24        116632-116833
            1585-1683           AL590787.24        122211-122309
            1684-1779           AL646102.4         3322-3417
            1780-2018           AL138958.18        12252-12490
FEATURES             Location/Qualifiers
     source          1..2018
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="13"
                     /map="13q12.13"
     gene            1..2018
                     /gene="NUP58"
                     /gene_synonym="NUP45; NUPL1; PRO2463"
                     /note="nucleoporin 58"
                     /db_xref="GeneID:9818"
                     /db_xref="HGNC:HGNC:20261"
                     /db_xref="MIM:607615"
     exon            1..256
                     /gene="NUP58"
                     /gene_synonym="NUP45; NUPL1; PRO2463"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    87..89
                     /gene="NUP58"
                     /gene_synonym="NUP45; NUPL1; PRO2463"
                     /note="upstream in-frame stop codon"
     CDS             150..1862
                     /gene="NUP58"
                     /gene_synonym="NUP45; NUPL1; PRO2463"
                     /note="isoform c is encoded by transcript variant 3;
                     nucleoporin p58/p45; nucleoporin-like protein 1;
                     nucleoporin like 1; 58 kDa nucleoporin; nucleoporin 58kDa"
                     /codon_start=1
                     /product="nucleoporin p58/p45 isoform c"
                     /protein_id="NP_001397930.1"
                     /db_xref="CCDS:CCDS91790.1"
                     /db_xref="GeneID:9818"
                     /db_xref="HGNC:HGNC:20261"
                     /db_xref="MIM:607615"
                     /translation="

MSTGFSFGSGTLGSTTVAAGGTSTGGVFSFGTGASSNPSVGLNFGNLGSTSTPATTSAPSSGFGTGLFGSKPATGFTLGGTNTGIATTITTGLTLGTPATTSAATTGFSLGFNKPAASATPFALPITSTSASGLTLSSALTSTPAASTGFTLNNLGGTTATTTTASTGLSLGGALAGLGGSLFQSTNTGTSGLGQNALGLTLGTTAATSTAGNEGLGGIDFSSSSDKKSDKTGTRPEDSKALKDENLPPVICQDVENLQKFVKEQKQVQEEISRMSSKAMLKVQEDIKALKQLLSLAANGIQRNTLNIDKLKIETAQELKNAEIALRTQKTPPGLQHEYAAPADYFRILVQQFEVQLQQYRQQIEELENHLATQANNSHITPQDLSMAMQKIYQTFVALAAQLQSIHENVKVLKEQYLGYRKMFLGDAVDVFETRRAEAKKWQNTPRVTTGPTPFSTMPNAAAVAMAATLTQQQQPATGPQPSLGVSFGTPFGSGIGTGLQSSGLGSSNLGGFGTSSGFGCSTTGASTFGFGTTNKPSGSLSAGNKSQVLTEFRKPSVTETNEIGRKIQF"

     misc_feature    156..1808
                     /gene="NUP58"
                     /gene_synonym="NUP45; NUPL1; PRO2463"
                     /note="Nucleoporin FG repeated region; Region:
                     Nucleoporin_FG2; pfam15967"
                     /db_xref="CDD:435043"
     exon            257..399
                     /gene="NUP58"
                     /gene_synonym="NUP45; NUPL1; PRO2463"
                     /inference="alignment:Splign:2.1.0"
     exon            400..435
                     /gene="NUP58"
                     /gene_synonym="NUP45; NUPL1; PRO2463"
                     /inference="alignment:Splign:2.1.0"
     exon            436..585
                     /gene="NUP58"
                     /gene_synonym="NUP45; NUPL1; PRO2463"
                     /inference="alignment:Splign:2.1.0"
     exon            586..723
                     /gene="NUP58"
                     /gene_synonym="NUP45; NUPL1; PRO2463"
                     /inference="alignment:Splign:2.1.0"
     exon            724..834
                     /gene="NUP58"
                     /gene_synonym="NUP45; NUPL1; PRO2463"
                     /inference="alignment:Splign:2.1.0"
     exon            835..859
                     /gene="NUP58"
                     /gene_synonym="NUP45; NUPL1; PRO2463"
                     /inference="alignment:Splign:2.1.0"
     exon            860..925
                     /gene="NUP58"
                     /gene_synonym="NUP45; NUPL1; PRO2463"
                     /inference="alignment:Splign:2.1.0"
     exon            926..1100
                     /gene="NUP58"
                     /gene_synonym="NUP45; NUPL1; PRO2463"
                     /inference="alignment:Splign:2.1.0"
     exon            1101..1180
                     /gene="NUP58"
                     /gene_synonym="NUP45; NUPL1; PRO2463"
                     /inference="alignment:Splign:2.1.0"
     exon            1181..1299
                     /gene="NUP58"
                     /gene_synonym="NUP45; NUPL1; PRO2463"
                     /inference="alignment:Splign:2.1.0"
     exon            1300..1382
                     /gene="NUP58"
                     /gene_synonym="NUP45; NUPL1; PRO2463"
                     /inference="alignment:Splign:2.1.0"
     exon            1383..1584
                     /gene="NUP58"
                     /gene_synonym="NUP45; NUPL1; PRO2463"
                     /inference="alignment:Splign:2.1.0"
     exon            1585..1683
                     /gene="NUP58"
                     /gene_synonym="NUP45; NUPL1; PRO2463"
                     /inference="alignment:Splign:2.1.0"
     exon            1684..1779
                     /gene="NUP58"
                     /gene_synonym="NUP45; NUPL1; PRO2463"
                     /inference="alignment:Splign:2.1.0"
     exon            1780..2018
                     /gene="NUP58"
                     /gene_synonym="NUP45; NUPL1; PRO2463"
                     /inference="alignment:Splign:2.1.0"
     regulatory      1988..1993
                     /regulatory_class="polyA_signal_sequence"
                     /gene="NUP58"
                     /gene_synonym="NUP45; NUPL1; PRO2463"
                     /note="hexamer: AATAAA"
     polyA_site      2018
                     /gene="NUP58"
                     /gene_synonym="NUP45; NUPL1; PRO2463"
                     /note="major polyA site"
ORIGIN      

agccttgccttcgccgccgttggggctggaagttcccgccaggtccgtgccgggcgagagagatgctgcccggcccgcctcggctttgaggcgagagaagtgtcccagacccatttcgccttgctgacggcgtcgagccctggccagacatgtccacagggttctccttcgggtccgggactctgggctccaccaccgtggccgccggcgggaccagcacaggcggcgttttctccttcggaacgggagcgtctagcaacccttctgtggggctcaattttggaaatcttggaagtacttcaactccagcaactacatctgctccttcaagtggttttggaaccgggctctttggatctaaacctgccactgggttcactctaggaggaacaaatacaggaatagcaacaactataactacaggattaactctgggaacgccagccactacatctgcagctacaacaggcttcagtttaggattcaataaacctgcagcatctgccacaccatttgctctacctattacctctacctcagctagcggtctgactctttcgtctgctctgacatcaactccagcagcatccacaggatttactctaaataatttgggtgggacaacagccacaactacaactgcatcaacaggcctctctttagggggagccttagctggtttgggaggttcacttttccagagtacaaacacaggaacatcaggacttggacagaatgctttagggttgactttgggaactacagcagctacttcaactgcaggcaatgaaggccttggtggtatagatttcagtagctcctcagataaaaagagtgataaaacgggaacaagaccagaggatagtaaagctctgaaggatgaaaatctacctcctgtcatctgccaggatgttgaaaatctccagaaatttgtgaaggagcagaaacaagttcaagaagaaattagtagaatgtcttcaaaagcaatgcttaaggtacaagaagatattaaagctctgaagcagctcctgtcgttggctgccaatggaatacagagaaacactctcaacattgacaaattgaaaatagaaactgctcaggagttgaagaatgctgaaatagctttaagaacccagaagacaccacctggacttcaacatgaatatgcagctcctgctgactacttcagaatcttggttcagcaatttgaggtacagcttcagcagtacaggcagcagattgaagaactagaaaaccatcttgccactcaagcaaataattcacatataacccctcaagatttgtcaatggctatgcagaaaatttatcaaacatttgtagctttagcggcacaacttcagtctattcatgaaaatgtaaaggttctgaaagaacagtaccttggctacaggaaaatgttcttgggagatgctgttgatgtgtttgaaacaaggcgagcagaagccaagaagtggcagaacacacccagagttactactggacccactcctttcagcaccatgccaaacgcagcagccgttgccatggctgcaacacttacacagcagcaacagcctgctacagggccacagccatctctgggagttagttttggaacgccattcggctcaggtattggcactggcttgcaatcaagtggcttaggttcttcaaaccttggaggatttggaactagctctggttttggatgcagcaccacaggggcctccacatttggatttggaacaacaaataaaccctcaggaagtcttagtgcaggcaacaaatcacaggttttaactgaatttcgaaaacccagtgttacagaaaccaatgaaataggaagaaaaatacagttctgagcagtccttgaatcaacaaatatctacctttaaggaacttctaattctcattttgtaaatcccattattcaagaaaagcacattaagcttagagtaggtttgatcaagatgtttagaattaaggaaataaaacttgcctttggtgtttaaggacaa

//