GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-02 10:00:17, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       NM_001407341            2333 bp    mRNA    linear   PRI 23-NOV-2023
DEFINITION  Homo sapiens tropomyosin 1 (TPM1), transcript variant 39, mRNA.
ACCESSION   NM_001407341
VERSION     NM_001407341.1
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 2333)
  AUTHORS   Nefedova VV, Kopylova GV, Shchepkin DV, Kochurova AM, Kechko OI,
            Borzova VA, Ryabkova NS, Katrukha IA, Mitkevich VA, Bershitsky SY,
            Levitsky DI and Matyushenko AM.
  TITLE     Impact of Troponin in Cardiomyopathy Development Caused by
            Mutations in Tropomyosin
  JOURNAL   Int J Mol Sci 23 (24), 15723 (2022)
   PUBMED   36555368
  REMARK    GeneRIF: Impact of Troponin in Cardiomyopathy Development Caused by
            Mutations in Tropomyosin.
            Publication Status: Online-Only
REFERENCE   2  (bases 1 to 2333)
  AUTHORS   Li C, Hong S, Hu H, Liu T, Yan G and Sun D.
  TITLE     MYC-Induced Upregulation of Lncrna ELFN1-AS1 Contributes to Tumor
            Growth in Colorectal Cancer via Epigenetically Silencing TPM1
  JOURNAL   Mol Cancer Res 20 (11), 1697-1708 (2022)
   PUBMED   35857351
  REMARK    GeneRIF: MYC-Induced Upregulation of Lncrna ELFN1-AS1 Contributes
            to Tumor Growth in Colorectal Cancer via Epigenetically Silencing
            TPM1.
REFERENCE   3  (bases 1 to 2333)
  AUTHORS   Teekakirikul P, Zhu W, Xu X, Young CB, Tan T, Smith AM, Wang C,
            Peterson KA, Gabriel GC, Ho S, Sheng Y, Moreau de Bellaing A,
            Sonnenberg DA, Lin JH, Fotiou E, Tenin G, Wang MX, Wu YL, Feinstein
            T, Devine W, Gou H, Bais AS, Glennon BJ, Zahid M, Wong TC, Ahmad F,
            Rynkiewicz MJ, Lehman WJ, Keavney B, Alastalo TP, Freckmann ML,
            Orwig K, Murray S, Ware SM, Zhao H, Feingold B and Lo CW.
  TITLE     Genetic resiliency associated with dominant lethal TPM1 mutation
            causing atrial septal defect with high heritability
  JOURNAL   Cell Rep Med 3 (2), 100501 (2022)
   PUBMED   35243414
  REMARK    GeneRIF: Genetic resiliency associated with dominant lethal TPM1
            mutation causing atrial septal defect with high heritability.
            Publication Status: Online-Only
REFERENCE   4  (bases 1 to 2333)
  AUTHORS   Man Y, Yi C, Fan M, Yang T, Liu P, Liu S and Wang G.
  TITLE     Identification of a novel missense mutation in the TPM1 gene via
            exome sequencing in a Chinese family with dilated cardiomyopathy: A
            case report and literature review
  JOURNAL   Medicine (Baltimore) 101 (2), e28551 (2022)
   PUBMED   35029218
  REMARK    GeneRIF: Identification of a novel missense mutation in the TPM1
            gene via exome sequencing in a Chinese family with dilated
            cardiomyopathy: A case report and literature review.
            Review article
REFERENCE   5  (bases 1 to 2333)
  AUTHORS   Geeves MA, Hitchcock-DeGregori SE and Gunning PW.
  TITLE     A systematic nomenclature for mammalian tropomyosin isoforms
  JOURNAL   J Muscle Res Cell Motil 36 (2), 147-153 (2015)
   PUBMED   25369766
  REMARK    Review article
REFERENCE   6  (bases 1 to 2333)
  AUTHORS   Cirino,A.L. and Ho,C.
  TITLE     Hypertrophic Cardiomyopathy Overview
  JOURNAL   (in) Adam MP, Feldman J, Mirzaa GM, Pagon RA, Wallace SE, Bean LJH,
            Gripp KW and Amemiya A (Eds.);
            GENEREVIEWS(R);
            (1993)
   PUBMED   20301725
REFERENCE   7  (bases 1 to 2333)
  AUTHORS   Hershberger,R.E. and Jordan,E.
  TITLE     Dilated Cardiomyopathy Overview
  JOURNAL   (in) Adam MP, Feldman J, Mirzaa GM, Pagon RA, Wallace SE, Bean LJH,
            Gripp KW and Amemiya A (Eds.);
            GENEREVIEWS(R);
            (1993)
   PUBMED   20301486
REFERENCE   8  (bases 1 to 2333)
  AUTHORS   Chevray PM and Nathans D.
  TITLE     Protein interaction cloning in yeast: identification of mammalian
            proteins that react with the leucine zipper of Jun
  JOURNAL   Proc Natl Acad Sci U S A 89 (13), 5789-5793 (1992)
   PUBMED   1631061
REFERENCE   9  (bases 1 to 2333)
  AUTHORS   Lees-Miller JP and Helfman DM.
  TITLE     The molecular basis for tropomyosin isoform diversity
  JOURNAL   Bioessays 13 (9), 429-437 (1991)
   PUBMED   1796905
  REMARK    Review article
REFERENCE   10 (bases 1 to 2333)
  AUTHORS   Mak,A., Smillie,L.B. and Barany,M.
  TITLE     Specific phosphorylation at serine-283 of alpha tropomyosin from
            frog skeletal and rabbit skeletal and cardiac muscle
  JOURNAL   Proc Natl Acad Sci U S A 75 (8), 3588-3592 (1978)
   PUBMED   278975
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from AC079328.11.
            
            Summary: This gene is a member of the tropomyosin family of highly
            conserved, widely distributed actin-binding proteins involved in
            the contractile system of striated and smooth muscles and the
            cytoskeleton of non-muscle cells. Tropomyosin is composed of two
            alpha-helical chains arranged as a coiled-coil. It is polymerized
            end to end along the two grooves of actin filaments and provides
            stability to the filaments. The encoded protein is one type of
            alpha helical chain that forms the predominant tropomyosin of
            striated muscle, where it also functions in association with the
            troponin complex to regulate the calcium-dependent interaction of
            actin and myosin during muscle contraction. In smooth muscle and
            non-muscle cells, alternatively spliced transcript variants
            encoding a range of isoforms have been described. Mutations in this
            gene are associated with type 3 familial hypertrophic
            cardiomyopathy and dilated cardiomyopathy 1Y. [provided by RefSeq,
            Jun 2022].
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: SRR14038191.4178994.1,
                                           SRR14038192.2148470.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA1965299, SAMEA1966682
                                           [ECO:0000348]
            ##Evidence-Data-END##
            COMPLETENESS: full length.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-219               AC079328.11        141008-141226
            220-353             AC079328.11        149504-149637
            354-471             AC079328.11        152082-152199
            472-542             AC079328.11        153388-153458
            543-618             AC079328.11        154232-154307
            619-681             AC079328.11        154734-154796
            682-2333            AC079328.11        155095-156746
FEATURES             Location/Qualifiers
     source          1..2333
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="15"
                     /map="15q22.2"
     gene            1..2333
                     /gene="TPM1"
                     /gene_synonym="C15orf13; CMD1Y; CMH3; HEL-S-265;
                     HTM-alpha; LVNC9; TMSA"
                     /note="tropomyosin 1"
                     /db_xref="GeneID:7168"
                     /db_xref="HGNC:HGNC:12010"
                     /db_xref="MIM:191010"
     exon            1..219
                     /gene="TPM1"
                     /gene_synonym="C15orf13; CMD1Y; CMH3; HEL-S-265;
                     HTM-alpha; LVNC9; TMSA"
                     /inference="alignment:Splign:2.1.0"
     CDS             88..915
                     /gene="TPM1"
                     /gene_synonym="C15orf13; CMD1Y; CMH3; HEL-S-265;
                     HTM-alpha; LVNC9; TMSA"
                     /note="isoform 39 is encoded by transcript variant 39;
                     cardiomyopathy, hypertrophic 3; tropomyosin alpha-1 chain;
                     sarcomeric tropomyosin kappa; epididymis secretory protein
                     Li 265"
                     /codon_start=1
                     /product="tropomyosin alpha-1 chain isoform 39"
                     /protein_id="NP_001394270.1"
                     /db_xref="GeneID:7168"
                     /db_xref="HGNC:HGNC:12010"
                     /db_xref="MIM:191010"
                     /translation="
MAGSSSLEAVRRKIRSLQEQADAAEERAGTLQRELDHERKLRETAEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRKYEEVARKLVIIESDLERAEERAELSEGKCAELEEELKTVTNNLKSLEAQAEKYSQKEDRYEEEIKVLSDKLKEAETRAEFAERSVTKLEKSIDDLEGKILSSVFSLILMVEYQPGKTIFQFKGIHIDTLLCTCTFFLCVLWGFSLWLLNS"
     misc_feature    121..765
                     /gene="TPM1"
                     /gene_synonym="C15orf13; CMD1Y; CMH3; HEL-S-265;
                     HTM-alpha; LVNC9; TMSA"
                     /note="Region: Tropomyosin; pfam00261"
                     /db_xref="CDD:425563"
     exon            220..353
                     /gene="TPM1"
                     /gene_synonym="C15orf13; CMD1Y; CMH3; HEL-S-265;
                     HTM-alpha; LVNC9; TMSA"
                     /inference="alignment:Splign:2.1.0"
     exon            354..471
                     /gene="TPM1"
                     /gene_synonym="C15orf13; CMD1Y; CMH3; HEL-S-265;
                     HTM-alpha; LVNC9; TMSA"
                     /inference="alignment:Splign:2.1.0"
     exon            472..542
                     /gene="TPM1"
                     /gene_synonym="C15orf13; CMD1Y; CMH3; HEL-S-265;
                     HTM-alpha; LVNC9; TMSA"
                     /inference="alignment:Splign:2.1.0"
     exon            543..618
                     /gene="TPM1"
                     /gene_synonym="C15orf13; CMD1Y; CMH3; HEL-S-265;
                     HTM-alpha; LVNC9; TMSA"
                     /inference="alignment:Splign:2.1.0"
     exon            619..681
                     /gene="TPM1"
                     /gene_synonym="C15orf13; CMD1Y; CMH3; HEL-S-265;
                     HTM-alpha; LVNC9; TMSA"
                     /inference="alignment:Splign:2.1.0"
     exon            682..2333
                     /gene="TPM1"
                     /gene_synonym="C15orf13; CMD1Y; CMH3; HEL-S-265;
                     HTM-alpha; LVNC9; TMSA"
                     /inference="alignment:Splign:2.1.0"
     regulatory      2299..2304
                     /regulatory_class="polyA_signal_sequence"
                     /gene="TPM1"
                     /gene_synonym="C15orf13; CMD1Y; CMH3; HEL-S-265;
                     HTM-alpha; LVNC9; TMSA"
                     /note="hexamer: AATAAA"
     polyA_site      2333
                     /gene="TPM1"
                     /gene_synonym="C15orf13; CMD1Y; CMH3; HEL-S-265;
                     HTM-alpha; LVNC9; TMSA"
                     /note="major polyA site"
ORIGIN      
agccaggacagccgcggcagccgggtccgcagggcagcagccggcctctcccactgcagccctcccgcccgcctaccgtccggcgcgatggcggggagtagctcgctggaggcggtgcgcaggaagatccggagcctgcaggagcaggcggacgccgctgaggagcgcgcgggcaccctgcagcgcgagctggaccacgagaggaagctgagggagaccgctgaagccgacgtagcttctctgaacagacgcatccagctggttgaggaagagttggatcgtgcccaggagcgtctggcaacagctttgcagaagctggaggaagctgagaaggcagcagatgagagtgagagaggcatgaaagtcattgagagtcgagcccaaaaagatgaagaaaaaatggaaattcaggagatccaactgaaagaggccaagcacattgctgaagatgccgaccgcaaatatgaagaggtggcccgtaagctggtcatcattgagagcgacctggaacgtgcagaggagcgggctgagctctcagaaggcaaatgtgccgagcttgaagaagaattgaaaactgtgacgaacaacttgaagtcactggaggctcaggctgagaagtactcgcagaaggaagacagatatgaggaagagatcaaggtcctttccgacaagctgaaggaggctgagactcgggctgagtttgcggagaggtcagtaactaaattggagaaaagcattgatgacttagaaggtaagatcttaagtagtgtttttagtttaatccttatggttgaataccaacctggcaaaacaattttccaattcaagggcatccacattgatacgctcctttgcacttgcacattcttcctgtgtgtcctctggggtttttctctgtggctcttgaactcatgaacctaagtcttctgctcacgaggtgactagttagccaccagccatagtggcaaatgccatccagcttgacttcatgctcattacaagtgtggcaggtttatttttcactgtgagtgaggtgcttattggtgagaatgactctagtatattttatatctttagtgttacttcctaattaaattgggaatgatgtggtgattgtggtcttgtttttagaagaacccatcttcttccaagtatgaattcaaagtaaggatttaggggttattttaagtcatatattatcttaacaaaatactttatatcctgaaggaggagggaaaaattatacttaagcatttcttccctaaggcacttaggttttattttagtaataaccactctatctcacagatatcctaaatgttgagctttgaagcttgtgaaggattagctgtgaacaagaaagaaaaaagacaaatatctacatcacagaagggattagagaaggaactagtgtttggtgcagataataaccaaaatagtggagaagagagaatgacaaatggttgcaaaatgatctgccaaagtgcagcaaagtatgaaacctgcagcattacaaaaactaagttgcagacttgccatataaagtgtggcgcccattgcttttcaagcctcctggaccagtaataggcagcttgagtgggaagaccacaggagtagcttaaatggcactaagaaatcgctatcccagtggtctagtgtggtcaggaagtcagtggtttgaaggtggaaccagataaggactacaggctgtagtcacaaattgttcttccaaaacactgcccttgcatttttttcccattgtttatagctgcagatgcctgactactccagtgtaattaaaatatagctctgcaaaagaaagatgttccattagcccctgcctcccctcaccaggagacagccttctgtggtttcgtttacaatttaacatggtttactgatatacctaccatatttgttaggattttcatattgagtctttttcattttattttctaatgggttttgttctctttgtttttgtttcaatttacttaaaacaaaacgcacgcctcctgcattggccacctgctgcggcaccaaccccttcatgcattgcccttttcttgctgctgtgttgggatggtgcgcgcaccaccctcactcaccctccatttcttgatcactctccatgttcttgcacctctgccttccacttcctggtcatagacgagctgtacgctcagaaactgaagtacaaagccatcagcgaggagctggaccacgctctcaacgatatgacttccatgtaaacgttcatccactctgcctgcttacaccctgccctcatgctaatgtaataaactcaccaccatgccttccttgctccctaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]