LOCUS       NM_001396083             321 bp    mRNA    linear   PRI 31-DEC-2022
DEFINITION  Homo sapiens small cysteine and glycine repeat containing 10
            (gene/pseudogene) (SCYGR10), transcript variant 1, mRNA.
ACCESSION   NM_001396083
VERSION     NM_001396083.1
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 321)
  AUTHORS   Wu DD, Irwin DM and Zhang YP.
  TITLE     Molecular evolution of the keratin associated protein gene family
            in mammals, role in the evolution of mammalian hair
  JOURNAL   BMC Evol Biol 8, 241 (2008)
   PUBMED   18721477
  REMARK    Erratum:[BMC Evol Biol. 2009;9:213]
            Publication Status: Online-Only
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            CM004594.1.
            
            Summary: This gene is a member of a large gene family that encodes
            keratin associated proteins (KRTAP) that play a role in hair
            formation. This gene belongs to a subfamily of the KRTAP family
            termed small cysteine and glycine repeat containing (SCYGR) genes
            and it resides in a cluster of SCYGR genes on chromosome 2q36.3.
            Allelic polymorphisms in this gene result in both coding and
            non-coding variants; the reference genome represents the non-coding
            allele. [provided by RefSeq, Sep 2021].
            
            Transcript Variant: This variant (1) represents a common allele
            that is predicted to encode a protein of 106 aa.
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on single protein-coding transcript
            ##RefSeq-Attributes-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-321               CM004594.1         222175361-222175681
FEATURES             Location/Qualifiers
     source          1..321
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="2"
                     /map="2q36.3"
     gene            1..321
                     /gene="SCYGR10"
                     /gene_synonym="KRTAP28-10; KRTAP28p2"
                     /note="small cysteine and glycine repeat containing 10
                     (gene/pseudogene)"
                     /db_xref="GeneID:112441436"
                     /db_xref="HGNC:HGNC:34221"
     CDS             1..321
                     /gene="SCYGR10"
                     /gene_synonym="KRTAP28-10; KRTAP28p2"
                     /note="keratin associated protein 28-910; keratin
                     associated protein 28 family pseudogene 2"
                     /codon_start=1
                     /product="small cysteine and glycine repeat-containing
                     protein 10"
                     /protein_id="NP_001383012.1"
                     /db_xref="GeneID:112441436"
                     /db_xref="HGNC:HGNC:34221"
                     /translation="

MGCCGCGGCGGRCSGGCGGGCGGGCGGGCGGGCGGGCGGDCGSCTTCRCYRVGCCSSCCPCCRGCCGGCCSTPVICCCRRTCRSCGCSCGKSCCQQKCCCQKQCCC"

     exon            1..321
                     /gene="SCYGR10"
                     /gene_synonym="KRTAP28-10; KRTAP28p2"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      

atgggttgctgtggttgtggtggctgcggtggccgctgcagtggtggctgtggtggtggctgtggtggtggctgcggtggtggctgtggtggtggctgtggtggtggctgcggtggtgactgtggcagctgcaccacctgcaggtgctaccgggtgggctgctgctccagctgctgcccctgctgccgcggctgctgtggaggctgctgcagcactcccgtgatctgctgttgccgccgcacctgccgctcatgtggctgcagctgtgggaagagctgttgccagcagaagtgctgctgccagaagcaatgctgctgttag

//