2024-05-08 00:17:42, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_001396063 1179 bp mRNA linear PRI 31-DEC-2022 DEFINITION Homo sapiens testis specific protein Y-linked 9 (TSPY9), mRNA. ACCESSION NM_001396063 VERSION NM_001396063.1 KEYWORDS RefSeq; MANE Select. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 1179) AUTHORS Lau YC, Li Y and Kido T. TITLE Battle of the sexes: contrasting roles of testis-specific protein Y-encoded (TSPY) and TSPX in human oncogenesis JOURNAL Asian J Androl 21 (3), 260-269 (2019) PUBMED 29974883 REMARK Review article REFERENCE 2 (bases 1 to 1179) AUTHORS Xue Y and Tyler-Smith C. TITLE An Exceptional Gene: Evolution of the TSPY Gene Family in Humans and Other Great Apes JOURNAL Genes (Basel) 2 (1), 36-47 (2011) PUBMED 24710137 REMARK Publication Status: Online-Only REFERENCE 3 (bases 1 to 1179) AUTHORS Delbridge ML, Longepied G, Depetris D, Mattei MG, Disteche CM, Marshall Graves JA and Mitchell MJ. TITLE TSPY, the candidate gonadoblastoma gene on the human Y chromosome, has a widely expressed homologue on the X - implications for Y chromosome evolution JOURNAL Chromosome Res 12 (4), 345-356 (2004) PUBMED 15241014 REFERENCE 4 (bases 1 to 1179) AUTHORS Vogel T and Schmidtke J. TITLE Structure and function of TSPY, the Y-chromosome gene coding for the 'testis-specific protein' JOURNAL Cytogenet Cell Genet 80 (1-4), 209-213 (1998) PUBMED 9678360 REMARK Review article REFERENCE 5 (bases 1 to 1179) AUTHORS Manz E, Schnieders F, Brechlin AM and Schmidtke J. TITLE TSPY-related sequences represent a microheterogeneous gene family organized as constitutive elements in DYZ5 tandem repeat units on the human Y chromosome JOURNAL Genomics 17 (3), 726-731 (1993) PUBMED 8244388 COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from AC006156.5. ##Evidence-Data-START## RNAseq introns :: single sample supports all introns SAMEA1968968, SAMEA2148093 [ECO:0000348] ##Evidence-Data-END## ##RefSeq-Attributes-START## MANE Ensembl match :: ENST00000440215.5/ ENSP00000499192.1 RefSeq Select criteria :: based on manual assertion, expression, longest protein ##RefSeq-Attributes-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-550 AC006156.5 33554-34103 551-628 AC006156.5 34711-34788 629-740 AC006156.5 34917-35028 741-886 AC006156.5 35130-35275 887-968 AC006156.5 35382-35463 969-1179 AC006156.5 36158-36368 FEATURES Location/Qualifiers source 1..1179 /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="Y" /map="Yp11.2" gene 1..1179 /gene="TSPY9" /gene_synonym="TSPY9P" /note="testis specific protein Y-linked 9" /db_xref="GeneID:728132" /db_xref="HGNC:HGNC:37472" exon 1..550 /gene="TSPY9" /gene_synonym="TSPY9P" /inference="alignment:Splign:2.1.0" variation 38 /gene="TSPY9" /gene_synonym="TSPY9P" /replace="c" /replace="g" /db_xref="dbSNP:1556183928" CDS 47..991 /gene="TSPY9" /gene_synonym="TSPY9P" /note="testis specific protein Y-linked 9, pseudogene" /codon_start=1 /product="testis-specific Y-encoded protein 9" /protein_id="NP_001382992.1" /db_xref="CCDS:CCDS94712.1" /db_xref="GeneID:728132" /db_xref="HGNC:HGNC:37472" /translation="
MRPEGSLTYRVPERLRQGFCGVGRAAQALVCASAKEGTAFRMEAVQEGAAGVESEQAALGEEAVLLLDDIMAEVEVVAEVEVVAEEEGLVERREEAQRAQQAVPGPGPMTPESALEELLAVQVELEPVNAQARKAFSRQREKMERRRKPQLDRRGAVIQSVPGFWANVIANHPQMSALITDEDEDMLSYMVSLEVEEEKHPVHLCKIMLFFRSNPYFQNKVITKEYLVNITEYRASHSTPIEWYPDYEVEAYRRRHHNSSLNFFNWFSDHNFAGSNKIAEILCKDLWRNPLQYYKRMKPPEEGTETSGDSQLLS"
misc_feature 440..928 /gene="TSPY9" /gene_synonym="TSPY9P" /note="Nucleosome assembly protein (NAP); Region: NAP; cl08298" /db_xref="CDD:447601" variation 73 /gene="TSPY9" /gene_synonym="TSPY9P" /replace="c" /replace="t" /db_xref="dbSNP:1556183934" variation 181 /gene="TSPY9" /gene_synonym="TSPY9P" /replace="a" /replace="g" /db_xref="dbSNP:1259002950" variation 231 /gene="TSPY9" /gene_synonym="TSPY9P" /replace="a" /replace="g" /db_xref="dbSNP:1603143867" variation 234 /gene="TSPY9" /gene_synonym="TSPY9P" /replace="c" /replace="t" /db_xref="dbSNP:2016060887" variation 293 /gene="TSPY9" /gene_synonym="TSPY9P" /replace="a" /replace="g" /db_xref="dbSNP:2124354815" variation 323 /gene="TSPY9" /gene_synonym="TSPY9P" /replace="c" /replace="t" /db_xref="dbSNP:1348459055" variation 327 /gene="TSPY9" /gene_synonym="TSPY9P" /replace="a" /replace="g" /db_xref="dbSNP:1603143871" variation 356 /gene="TSPY9" /gene_synonym="TSPY9P" /replace="c" /replace="t" /db_xref="dbSNP:2124354826" variation 377 /gene="TSPY9" /gene_synonym="TSPY9P" /replace="a" /replace="c" /db_xref="dbSNP:1603143872" variation 390 /gene="TSPY9" /gene_synonym="TSPY9P" /replace="c" /replace="t" /db_xref="dbSNP:1317472486" variation 415 /gene="TSPY9" /gene_synonym="TSPY9P" /replace="c" /replace="g" /db_xref="dbSNP:1603143877" variation 461 /gene="TSPY9" /gene_synonym="TSPY9P" /replace="c" /replace="t" /db_xref="dbSNP:2124354836" variation 496 /gene="TSPY9" /gene_synonym="TSPY9P" /replace="c" /replace="g" /db_xref="dbSNP:1194474203" variation 510 /gene="TSPY9" /gene_synonym="TSPY9P" /replace="g" /replace="t" /db_xref="dbSNP:2124354841" exon 551..628 /gene="TSPY9" /gene_synonym="TSPY9P" /inference="alignment:Splign:2.1.0" exon 629..740 /gene="TSPY9" /gene_synonym="TSPY9P" /inference="alignment:Splign:2.1.0" exon 741..886 /gene="TSPY9" /gene_synonym="TSPY9P" /inference="alignment:Splign:2.1.0" variation 775 /gene="TSPY9" /gene_synonym="TSPY9P" /replace="a" /replace="g" /db_xref="dbSNP:1556183981" variation 803 /gene="TSPY9" /gene_synonym="TSPY9P" /replace="c" /replace="t" /db_xref="dbSNP:1556183985" exon 887..968 /gene="TSPY9" /gene_synonym="TSPY9P" /inference="alignment:Splign:2.1.0" variation 964 /gene="TSPY9" /gene_synonym="TSPY9P" /replace="a" /replace="g" /db_xref="dbSNP:1556183997" exon 969..1179 /gene="TSPY9" /gene_synonym="TSPY9P" /inference="alignment:Splign:2.1.0" variation 975 /gene="TSPY9" /gene_synonym="TSPY9P" /replace="c" /replace="t" /db_xref="dbSNP:1556184001" variation 1034 /gene="TSPY9" /gene_synonym="TSPY9P" /replace="c" /replace="t" /db_xref="dbSNP:1556184007" variation 1037 /gene="TSPY9" /gene_synonym="TSPY9P" /replace="a" /replace="g" /db_xref="dbSNP:1556184012" variation 1072 /gene="TSPY9" /gene_synonym="TSPY9P" /replace="c" /replace="t" /db_xref="dbSNP:1603143945" variation 1078 /gene="TSPY9" /gene_synonym="TSPY9P" /replace="c" /replace="t" /db_xref="dbSNP:1603143946" variation 1079..1080 /gene="TSPY9" /gene_synonym="TSPY9P" /replace="tt" /replace="ttt" /db_xref="dbSNP:200341739" variation 1110 /gene="TSPY9" /gene_synonym="TSPY9P" /replace="a" /replace="g" /db_xref="dbSNP:1603143949" ORIGIN
ggcccttcgcgcgcagtcccttagggggcgcctggaagcccggcgcatgcgccctgagggctcgctgacctaccgggtgccagagaggctgcggcagggtttctgtggcgtgggtcgggcagcacaggccttggtgtgtgcgagtgccaaggagggcaccgccttcaggatggaggctgtacaggagggggcggccggggtggagagtgagcaggcggctttgggggaggaggcggtgctgctgttggatgacataatggcggaggtggaggtggtggcggaggtggaggtggtggcggaggaggagggcctcgtggagcggcgggaggaggcccagcgggcacagcaggctgtgcctggccctgggcccatgaccccagagtctgcactggaggagctgctggccgttcaggtggagctggagccggttaatgcccaagccaggaaggccttttctcggcagcgggaaaagatggagcggaggcgcaagccccagctagaccgcagaggcgccgtcatccagagcgtccctggcttctgggccaatgttattgcaaaccacccccagatgtcagccctgatcactgacgaagatgaagacatgctgagctacatggtcagcctggaggtggaagaagagaagcatcctgttcatctctgcaagatcatgttgttctttcggagtaacccctacttccagaataaagtgattaccaaggaatatctggtgaacatcacagaatacagggcttctcattccactccaattgagtggtatccggattatgaagtggaggcctatcgccgcagacaccacaacagcagccttaacttcttcaactggttctctgaccacaacttcgcaggatctaacaagattgctgagatcctatgtaaggacctgtggcgcaatcccctgcaatactacaagaggatgaagccacctgaagagggaacagagacgtcaggggactcccagttgttgagttgaatatgatggagcatcagattttacctaatacagcagaactcctaaaaagttacagccatatgcaggacggcagtactcagcatggtcttatgcacaggaactaaaggaaaaagagatcgagtcacaaaaattcaggaagagggggtaaatgtggattgtatggaatgaaaaataaacattctcaagga
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]