GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-02 14:09:18, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       NM_001396063            1179 bp    mRNA    linear   PRI 31-DEC-2022
DEFINITION  Homo sapiens testis specific protein Y-linked 9 (TSPY9), mRNA.
ACCESSION   NM_001396063
VERSION     NM_001396063.1
KEYWORDS    RefSeq; MANE Select.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1179)
  AUTHORS   Lau YC, Li Y and Kido T.
  TITLE     Battle of the sexes: contrasting roles of testis-specific protein
            Y-encoded (TSPY) and TSPX in human oncogenesis
  JOURNAL   Asian J Androl 21 (3), 260-269 (2019)
   PUBMED   29974883
  REMARK    Review article
REFERENCE   2  (bases 1 to 1179)
  AUTHORS   Xue Y and Tyler-Smith C.
  TITLE     An Exceptional Gene: Evolution of the TSPY Gene Family in Humans
            and Other Great Apes
  JOURNAL   Genes (Basel) 2 (1), 36-47 (2011)
   PUBMED   24710137
  REMARK    Publication Status: Online-Only
REFERENCE   3  (bases 1 to 1179)
  AUTHORS   Delbridge ML, Longepied G, Depetris D, Mattei MG, Disteche CM,
            Marshall Graves JA and Mitchell MJ.
  TITLE     TSPY, the candidate gonadoblastoma gene on the human Y chromosome,
            has a widely expressed homologue on the X - implications for Y
            chromosome evolution
  JOURNAL   Chromosome Res 12 (4), 345-356 (2004)
   PUBMED   15241014
REFERENCE   4  (bases 1 to 1179)
  AUTHORS   Vogel T and Schmidtke J.
  TITLE     Structure and function of TSPY, the Y-chromosome gene coding for
            the 'testis-specific protein'
  JOURNAL   Cytogenet Cell Genet 80 (1-4), 209-213 (1998)
   PUBMED   9678360
  REMARK    Review article
REFERENCE   5  (bases 1 to 1179)
  AUTHORS   Manz E, Schnieders F, Brechlin AM and Schmidtke J.
  TITLE     TSPY-related sequences represent a microheterogeneous gene family
            organized as constitutive elements in DYZ5 tandem repeat units on
            the human Y chromosome
  JOURNAL   Genomics 17 (3), 726-731 (1993)
   PUBMED   8244388
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            AC006156.5.
            
            ##Evidence-Data-START##
            RNAseq introns :: single sample supports all introns SAMEA1968968,
                              SAMEA2148093 [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            MANE Ensembl match     :: ENST00000440215.5/ ENSP00000499192.1
            RefSeq Select criteria :: based on manual assertion, expression,
                                      longest protein
            ##RefSeq-Attributes-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-550               AC006156.5         33554-34103
            551-628             AC006156.5         34711-34788
            629-740             AC006156.5         34917-35028
            741-886             AC006156.5         35130-35275
            887-968             AC006156.5         35382-35463
            969-1179            AC006156.5         36158-36368
FEATURES             Location/Qualifiers
     source          1..1179
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="Y"
                     /map="Yp11.2"
     gene            1..1179
                     /gene="TSPY9"
                     /gene_synonym="TSPY9P"
                     /note="testis specific protein Y-linked 9"
                     /db_xref="GeneID:728132"
                     /db_xref="HGNC:HGNC:37472"
     exon            1..550
                     /gene="TSPY9"
                     /gene_synonym="TSPY9P"
                     /inference="alignment:Splign:2.1.0"
     variation       38
                     /gene="TSPY9"
                     /gene_synonym="TSPY9P"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1556183928"
     CDS             47..991
                     /gene="TSPY9"
                     /gene_synonym="TSPY9P"
                     /note="testis specific protein Y-linked 9, pseudogene"
                     /codon_start=1
                     /product="testis-specific Y-encoded protein 9"
                     /protein_id="NP_001382992.1"
                     /db_xref="CCDS:CCDS94712.1"
                     /db_xref="GeneID:728132"
                     /db_xref="HGNC:HGNC:37472"
                     /translation="
MRPEGSLTYRVPERLRQGFCGVGRAAQALVCASAKEGTAFRMEAVQEGAAGVESEQAALGEEAVLLLDDIMAEVEVVAEVEVVAEEEGLVERREEAQRAQQAVPGPGPMTPESALEELLAVQVELEPVNAQARKAFSRQREKMERRRKPQLDRRGAVIQSVPGFWANVIANHPQMSALITDEDEDMLSYMVSLEVEEEKHPVHLCKIMLFFRSNPYFQNKVITKEYLVNITEYRASHSTPIEWYPDYEVEAYRRRHHNSSLNFFNWFSDHNFAGSNKIAEILCKDLWRNPLQYYKRMKPPEEGTETSGDSQLLS"
     misc_feature    440..928
                     /gene="TSPY9"
                     /gene_synonym="TSPY9P"
                     /note="Nucleosome assembly protein (NAP); Region: NAP;
                     cl08298"
                     /db_xref="CDD:447601"
     variation       73
                     /gene="TSPY9"
                     /gene_synonym="TSPY9P"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1556183934"
     variation       181
                     /gene="TSPY9"
                     /gene_synonym="TSPY9P"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1259002950"
     variation       231
                     /gene="TSPY9"
                     /gene_synonym="TSPY9P"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1603143867"
     variation       234
                     /gene="TSPY9"
                     /gene_synonym="TSPY9P"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2016060887"
     variation       293
                     /gene="TSPY9"
                     /gene_synonym="TSPY9P"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2124354815"
     variation       323
                     /gene="TSPY9"
                     /gene_synonym="TSPY9P"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1348459055"
     variation       327
                     /gene="TSPY9"
                     /gene_synonym="TSPY9P"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1603143871"
     variation       356
                     /gene="TSPY9"
                     /gene_synonym="TSPY9P"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2124354826"
     variation       377
                     /gene="TSPY9"
                     /gene_synonym="TSPY9P"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1603143872"
     variation       390
                     /gene="TSPY9"
                     /gene_synonym="TSPY9P"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1317472486"
     variation       415
                     /gene="TSPY9"
                     /gene_synonym="TSPY9P"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1603143877"
     variation       461
                     /gene="TSPY9"
                     /gene_synonym="TSPY9P"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2124354836"
     variation       496
                     /gene="TSPY9"
                     /gene_synonym="TSPY9P"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1194474203"
     variation       510
                     /gene="TSPY9"
                     /gene_synonym="TSPY9P"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:2124354841"
     exon            551..628
                     /gene="TSPY9"
                     /gene_synonym="TSPY9P"
                     /inference="alignment:Splign:2.1.0"
     exon            629..740
                     /gene="TSPY9"
                     /gene_synonym="TSPY9P"
                     /inference="alignment:Splign:2.1.0"
     exon            741..886
                     /gene="TSPY9"
                     /gene_synonym="TSPY9P"
                     /inference="alignment:Splign:2.1.0"
     variation       775
                     /gene="TSPY9"
                     /gene_synonym="TSPY9P"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1556183981"
     variation       803
                     /gene="TSPY9"
                     /gene_synonym="TSPY9P"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1556183985"
     exon            887..968
                     /gene="TSPY9"
                     /gene_synonym="TSPY9P"
                     /inference="alignment:Splign:2.1.0"
     variation       964
                     /gene="TSPY9"
                     /gene_synonym="TSPY9P"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1556183997"
     exon            969..1179
                     /gene="TSPY9"
                     /gene_synonym="TSPY9P"
                     /inference="alignment:Splign:2.1.0"
     variation       975
                     /gene="TSPY9"
                     /gene_synonym="TSPY9P"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1556184001"
     variation       1034
                     /gene="TSPY9"
                     /gene_synonym="TSPY9P"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1556184007"
     variation       1037
                     /gene="TSPY9"
                     /gene_synonym="TSPY9P"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1556184012"
     variation       1072
                     /gene="TSPY9"
                     /gene_synonym="TSPY9P"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1603143945"
     variation       1078
                     /gene="TSPY9"
                     /gene_synonym="TSPY9P"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1603143946"
     variation       1079..1080
                     /gene="TSPY9"
                     /gene_synonym="TSPY9P"
                     /replace="tt"
                     /replace="ttt"
                     /db_xref="dbSNP:200341739"
     variation       1110
                     /gene="TSPY9"
                     /gene_synonym="TSPY9P"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1603143949"
ORIGIN      
ggcccttcgcgcgcagtcccttagggggcgcctggaagcccggcgcatgcgccctgagggctcgctgacctaccgggtgccagagaggctgcggcagggtttctgtggcgtgggtcgggcagcacaggccttggtgtgtgcgagtgccaaggagggcaccgccttcaggatggaggctgtacaggagggggcggccggggtggagagtgagcaggcggctttgggggaggaggcggtgctgctgttggatgacataatggcggaggtggaggtggtggcggaggtggaggtggtggcggaggaggagggcctcgtggagcggcgggaggaggcccagcgggcacagcaggctgtgcctggccctgggcccatgaccccagagtctgcactggaggagctgctggccgttcaggtggagctggagccggttaatgcccaagccaggaaggccttttctcggcagcgggaaaagatggagcggaggcgcaagccccagctagaccgcagaggcgccgtcatccagagcgtccctggcttctgggccaatgttattgcaaaccacccccagatgtcagccctgatcactgacgaagatgaagacatgctgagctacatggtcagcctggaggtggaagaagagaagcatcctgttcatctctgcaagatcatgttgttctttcggagtaacccctacttccagaataaagtgattaccaaggaatatctggtgaacatcacagaatacagggcttctcattccactccaattgagtggtatccggattatgaagtggaggcctatcgccgcagacaccacaacagcagccttaacttcttcaactggttctctgaccacaacttcgcaggatctaacaagattgctgagatcctatgtaaggacctgtggcgcaatcccctgcaatactacaagaggatgaagccacctgaagagggaacagagacgtcaggggactcccagttgttgagttgaatatgatggagcatcagattttacctaatacagcagaactcctaaaaagttacagccatatgcaggacggcagtactcagcatggtcttatgcacaggaactaaaggaaaaagagatcgagtcacaaaaattcaggaagagggggtaaatgtggattgtatggaatgaaaaataaacattctcaagga
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]