ver.2
Home
|
Help
|
Advanced search
Previous release (v1)
2025-12-23 06:27:31, GGRNA.v2 : RefSeq release 232 (Sep, 2025)
LOCUS NM_001396063 1179 bp mRNA linear PRI 30-APR-2025
DEFINITION Homo sapiens testis specific protein Y-linked 9 (TSPY9), mRNA.
ACCESSION NM_001396063
VERSION NM_001396063.1
KEYWORDS RefSeq; MANE Select.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 1179)
AUTHORS Lau,Y.C., Li,Y. and Kido,T.
TITLE Battle of the sexes: contrasting roles of testis-specific protein
Y-encoded (TSPY) and TSPX in human oncogenesis
JOURNAL Asian J Androl 21 (3), 260-269 (2019)
PUBMED 29974883
REMARK Review article
REFERENCE 2 (bases 1 to 1179)
AUTHORS Xue,Y. and Tyler-Smith,C.
TITLE An Exceptional Gene: Evolution of the TSPY Gene Family in Humans
and Other Great Apes
JOURNAL Genes (Basel) 2 (1), 36-47 (2011)
PUBMED 24710137
REMARK Publication Status: Online-Only
REFERENCE 3 (bases 1 to 1179)
AUTHORS Delbridge,M.L., Longepied,G., Depetris,D., Mattei,M.G.,
Disteche,C.M., Marshall Graves,J.A. and Mitchell,M.J.
TITLE TSPY, the candidate gonadoblastoma gene on the human Y chromosome,
has a widely expressed homologue on the X - implications for Y
chromosome evolution
JOURNAL Chromosome Res 12 (4), 345-356 (2004)
PUBMED 15241014
REFERENCE 4 (bases 1 to 1179)
AUTHORS Vogel,T. and Schmidtke,J.
TITLE Structure and function of TSPY, the Y-chromosome gene coding for
the 'testis-specific protein'
JOURNAL Cytogenet Cell Genet 80 (1-4), 209-213 (1998)
PUBMED 9678360
REMARK Review article
REFERENCE 5 (bases 1 to 1179)
AUTHORS Manz,E., Schnieders,F., Brechlin,A.M. and Schmidtke,J.
TITLE TSPY-related sequences represent a microheterogeneous gene family
organized as constitutive elements in DYZ5 tandem repeat units on
the human Y chromosome
JOURNAL Genomics 17 (3), 726-731 (1993)
PUBMED 8244388
COMMENT VALIDATED REFSEQ: This record has undergone validation or
preliminary review. The reference sequence was derived from
AC006156.5.
##Evidence-Data-START##
RNAseq introns :: single sample supports all introns SAMEA1968968,
SAMEA2148093 [ECO:0000348]
##Evidence-Data-END##
##RefSeq-Attributes-START##
MANE Ensembl match :: ENST00000440215.5/ ENSP00000499192.1
RefSeq Select criteria :: based on manual assertion, expression,
longest protein
##RefSeq-Attributes-END##
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-550 AC006156.5 33554-34103
551-628 AC006156.5 34711-34788
629-740 AC006156.5 34917-35028
741-886 AC006156.5 35130-35275
887-968 AC006156.5 35382-35463
969-1179 AC006156.5 36158-36368
FEATURES Location/Qualifiers
source 1..1179
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="Y"
/map="Yp11.2"
gene 1..1179
/gene="TSPY9"
/gene_synonym="TSPY9P"
/note="testis specific protein Y-linked 9"
/db_xref="GeneID:728132"
/db_xref="HGNC:HGNC:37472"
exon 1..550
/gene="TSPY9"
/gene_synonym="TSPY9P"
/inference="alignment:Splign:2.1.0"
variation 24..28
/gene="TSPY9"
/gene_synonym="TSPY9P"
/replace="ggggg"
/replace="gggggg"
/db_xref="dbSNP:2520726060"
variation 38
/gene="TSPY9"
/gene_synonym="TSPY9P"
/replace="c"
/replace="g"
/db_xref="dbSNP:1556183928"
CDS 47..991
/gene="TSPY9"
/gene_synonym="TSPY9P"
/note="testis specific protein Y-linked 9, pseudogene"
/codon_start=1
/product="testis-specific Y-encoded protein 9"
/protein_id="NP_001382992.1"
/db_xref="CCDS:CCDS94712.1"
/db_xref="GeneID:728132"
/db_xref="HGNC:HGNC:37472"
/translation="
MRPEGSLTYRVPERLRQGFCGVGRAAQALVCASAKEGTAFRMEAVQEGAAGVESEQAALGEEAVLLLDDIMAEVEVVAEVEVVAEEEGLVERREEAQRAQQAVPGPGPMTPESALEELLAVQVELEPVNAQARKAFSRQREKMERRRKPQLDRRGAVIQSVPGFWANVIANHPQMSALITDEDEDMLSYMVSLEVEEEKHPVHLCKIMLFFRSNPYFQNKVITKEYLVNITEYRASHSTPIEWYPDYEVEAYRRRHHNSSLNFFNWFSDHNFAGSNKIAEILCKDLWRNPLQYYKRMKPPEEGTETSGDSQLLS"
misc_feature 440..928
/gene="TSPY9"
/gene_synonym="TSPY9P"
/note="(NAP-L) nucleosome assembly protein -L;
Provisional; Region: PTZ00007; cl08298"
/db_xref="CDD:471807"
variation 73
/gene="TSPY9"
/gene_synonym="TSPY9P"
/replace="c"
/replace="t"
/db_xref="dbSNP:1556183934"
variation 181
/gene="TSPY9"
/gene_synonym="TSPY9P"
/replace="a"
/replace="g"
/db_xref="dbSNP:1259002950"
variation 231
/gene="TSPY9"
/gene_synonym="TSPY9P"
/replace="a"
/replace="g"
/db_xref="dbSNP:1603143867"
variation 234
/gene="TSPY9"
/gene_synonym="TSPY9P"
/replace="c"
/replace="t"
/db_xref="dbSNP:2016060887"
variation 236
/gene="TSPY9"
/gene_synonym="TSPY9P"
/replace="c"
/replace="g"
/db_xref="dbSNP:2520726130"
variation 292
/gene="TSPY9"
/gene_synonym="TSPY9P"
/replace="g"
/replace="t"
/db_xref="dbSNP:2520726144"
variation 293
/gene="TSPY9"
/gene_synonym="TSPY9P"
/replace="a"
/replace="g"
/db_xref="dbSNP:2124354815"
variation 323
/gene="TSPY9"
/gene_synonym="TSPY9P"
/replace="c"
/replace="t"
/db_xref="dbSNP:1348459055"
variation 327
/gene="TSPY9"
/gene_synonym="TSPY9P"
/replace="a"
/replace="g"
/db_xref="dbSNP:1603143871"
variation 356
/gene="TSPY9"
/gene_synonym="TSPY9P"
/replace="c"
/replace="t"
/db_xref="dbSNP:2124354826"
variation 377
/gene="TSPY9"
/gene_synonym="TSPY9P"
/replace="a"
/replace="c"
/db_xref="dbSNP:1603143872"
variation 390
/gene="TSPY9"
/gene_synonym="TSPY9P"
/replace="c"
/replace="t"
/db_xref="dbSNP:1317472486"
variation 415
/gene="TSPY9"
/gene_synonym="TSPY9P"
/replace="c"
/replace="g"
/db_xref="dbSNP:1603143877"
variation 461
/gene="TSPY9"
/gene_synonym="TSPY9P"
/replace="c"
/replace="t"
/db_xref="dbSNP:2124354836"
variation 496
/gene="TSPY9"
/gene_synonym="TSPY9P"
/replace="c"
/replace="g"
/db_xref="dbSNP:1194474203"
variation 510
/gene="TSPY9"
/gene_synonym="TSPY9P"
/replace="g"
/replace="t"
/db_xref="dbSNP:2124354841"
exon 551..628
/gene="TSPY9"
/gene_synonym="TSPY9P"
/inference="alignment:Splign:2.1.0"
exon 629..740
/gene="TSPY9"
/gene_synonym="TSPY9P"
/inference="alignment:Splign:2.1.0"
exon 741..886
/gene="TSPY9"
/gene_synonym="TSPY9P"
/inference="alignment:Splign:2.1.0"
variation 775
/gene="TSPY9"
/gene_synonym="TSPY9P"
/replace="a"
/replace="g"
/db_xref="dbSNP:1556183981"
variation 803
/gene="TSPY9"
/gene_synonym="TSPY9P"
/replace="c"
/replace="t"
/db_xref="dbSNP:1556183985"
exon 887..968
/gene="TSPY9"
/gene_synonym="TSPY9P"
/inference="alignment:Splign:2.1.0"
variation 964
/gene="TSPY9"
/gene_synonym="TSPY9P"
/replace="a"
/replace="g"
/db_xref="dbSNP:1556183997"
exon 969..1179
/gene="TSPY9"
/gene_synonym="TSPY9P"
/inference="alignment:Splign:2.1.0"
variation 975
/gene="TSPY9"
/gene_synonym="TSPY9P"
/replace="c"
/replace="t"
/db_xref="dbSNP:1556184001"
variation 1034
/gene="TSPY9"
/gene_synonym="TSPY9P"
/replace="c"
/replace="t"
/db_xref="dbSNP:1556184007"
variation 1037
/gene="TSPY9"
/gene_synonym="TSPY9P"
/replace="a"
/replace="g"
/db_xref="dbSNP:1556184012"
variation 1072
/gene="TSPY9"
/gene_synonym="TSPY9P"
/replace="c"
/replace="t"
/db_xref="dbSNP:1603143945"
variation 1078
/gene="TSPY9"
/gene_synonym="TSPY9P"
/replace="c"
/replace="t"
/db_xref="dbSNP:1603143946"
variation 1079..1080
/gene="TSPY9"
/gene_synonym="TSPY9P"
/replace="tt"
/replace="ttt"
/db_xref="dbSNP:200341739"
variation 1084
/gene="TSPY9"
/gene_synonym="TSPY9P"
/replace="c"
/replace="t"
/db_xref="dbSNP:2520726714"
variation 1110
/gene="TSPY9"
/gene_synonym="TSPY9P"
/replace="a"
/replace="g"
/db_xref="dbSNP:1603143949"
ORIGIN
ggcccttcgcgcgcagtcccttagggggcgcctggaagcccggcgcatgcgccctgagggctcgctgacctaccgggtgccagagaggctgcggcagggtttctgtggcgtgggtcgggcagcacaggccttggtgtgtgcgagtgccaaggagggcaccgccttcaggatggaggctgtacaggagggggcggccggggtggagagtgagcaggcggctttgggggaggaggcggtgctgctgttggatgacataatggcggaggtggaggtggtggcggaggtggaggtggtggcggaggaggagggcctcgtggagcggcgggaggaggcccagcgggcacagcaggctgtgcctggccctgggcccatgaccccagagtctgcactggaggagctgctggccgttcaggtggagctggagccggttaatgcccaagccaggaaggccttttctcggcagcgggaaaagatggagcggaggcgcaagccccagctagaccgcagaggcgccgtcatccagagcgtccctggcttctgggccaatgttattgcaaaccacccccagatgtcagccctgatcactgacgaagatgaagacatgctgagctacatggtcagcctggaggtggaagaagagaagcatcctgttcatctctgcaagatcatgttgttctttcggagtaacccctacttccagaataaagtgattaccaaggaatatctggtgaacatcacagaatacagggcttctcattccactccaattgagtggtatccggattatgaagtggaggcctatcgccgcagacaccacaacagcagccttaacttcttcaactggttctctgaccacaacttcgcaggatctaacaagattgctgagatcctatgtaaggacctgtggcgcaatcccctgcaatactacaagaggatgaagccacctgaagagggaacagagacgtcaggggactcccagttgttgagttgaatatgatggagcatcagattttacctaatacagcagaactcctaaaaagttacagccatatgcaggacggcagtactcagcatggtcttatgcacaggaactaaaggaaaaagagatcgagtcacaaaaattcaggaagagggggtaaatgtggattgtatggaatgaaaaataaacattctcaagga
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]