GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-04-30 14:44:24, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       NM_001376861             556 bp    mRNA    linear   PRI 28-DEC-2022
DEFINITION  Homo sapiens ATPase H+ transporting V1 subunit G3 (ATP6V1G3),
            transcript variant 4, mRNA.
ACCESSION   NM_001376861 XM_006711163
VERSION     NM_001376861.1
KEYWORDS    RefSeq; MANE Select.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 556)
  AUTHORS   Chen Y and Hu J.
  TITLE     ATP6V1G3 Acts as a Key Gene in Recurrent Spontaneous Abortion: An
            Integrated Bioinformatics Analysis
  JOURNAL   Med Sci Monit 26, e927537 (2020)
   PUBMED   33028803
  REMARK    GeneRIF: ATP6V1G3 Acts as a Key Gene in Recurrent Spontaneous
            Abortion: An Integrated Bioinformatics Analysis.
            Publication Status: Online-Only
REFERENCE   2  (bases 1 to 556)
  AUTHORS   Low SK, Chung S, Takahashi A, Zembutsu H, Mushiroda T, Kubo M and
            Nakamura Y.
  TITLE     Genome-wide association study of chemotherapeutic agent-induced
            severe neutropenia/leucopenia for patients in Biobank Japan
  JOURNAL   Cancer Sci 104 (8), 1074-1082 (2013)
   PUBMED   23648065
REFERENCE   3  (bases 1 to 556)
  AUTHORS   Kamatani Y, Matsuda K, Okada Y, Kubo M, Hosono N, Daigo Y, Nakamura
            Y and Kamatani N.
  TITLE     Genome-wide association study of hematological and biochemical
            traits in a Japanese population
  JOURNAL   Nat Genet 42 (3), 210-215 (2010)
   PUBMED   20139978
REFERENCE   4  (bases 1 to 556)
  AUTHORS   Hinton A, Sennoune SR, Bond S, Fang M, Reuveni M, Sahagian GG, Jay
            D, Martinez-Zaguilan R and Forgac M.
  TITLE     Function of a subunit isoforms of the V-ATPase in pH homeostasis
            and in vitro invasion of MDA-MB231 human breast cancer cells
  JOURNAL   J Biol Chem 284 (24), 16400-16408 (2009)
   PUBMED   19366680
  REMARK    GeneRIF: V-ATPases affecting the pH of the cytosol and
            intracellular compartments, particularly those containing a3, are
            also involved in invasion in breast cancer
REFERENCE   5  (bases 1 to 556)
  AUTHORS   Adachi K, Oiwa K, Nishizaka T, Furuike S, Noji H, Itoh H, Yoshida M
            and Kinosita K Jr.
  TITLE     Coupling of rotation and catalysis in F(1)-ATPase revealed by
            single-molecule imaging and manipulation
  JOURNAL   Cell 130 (2), 309-321 (2007)
   PUBMED   17662945
REFERENCE   6  (bases 1 to 556)
  AUTHORS   Nelson N and Harvey WR.
  TITLE     Vacuolar and plasma membrane proton-adenosinetriphosphatases
  JOURNAL   Physiol Rev 79 (2), 361-385 (1999)
   PUBMED   10221984
  REMARK    Review article
REFERENCE   7  (bases 1 to 556)
  AUTHORS   Finbow ME and Harrison MA.
  TITLE     The vacuolar H+-ATPase: a universal proton pump of eukaryotes
  JOURNAL   Biochem J 324 (Pt 3) (Pt 3), 697-712 (1997)
   PUBMED   9210392
  REMARK    Review article
REFERENCE   8  (bases 1 to 556)
  AUTHORS   Stevens TH and Forgac M.
  TITLE     Structure, function and regulation of the vacuolar (H+)-ATPase
  JOURNAL   Annu Rev Cell Dev Biol 13, 779-808 (1997)
   PUBMED   9442887
  REMARK    Review article
REFERENCE   9  (bases 1 to 556)
  AUTHORS   Brown D, Lui B, Gluck S and Sabolic I.
  TITLE     A plasma membrane proton ATPase in specialized cells of rat
            epididymis
  JOURNAL   Am J Physiol 263 (4 Pt 1), C913-C916 (1992)
   PUBMED   1415677
REFERENCE   10 (bases 1 to 556)
  AUTHORS   Dautry-Varsat,A.
  TITLE     Receptor-mediated endocytosis: the intracellular journey of
            transferrin and its receptor
  JOURNAL   Biochimie 68 (3), 375-381 (1986)
   PUBMED   2874839
  REMARK    Review article
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from AI791754.1, BC101130.1 and
            BF509031.1.
            
            On Nov 20, 2019 this sequence version replaced XM_006711163.3.
            
            Summary: This gene encodes a component of vacuolar ATPase
            (V-ATPase), a multisubunit enzyme that mediates acidification of
            eukaryotic intracellular organelles. V-ATPase dependent organelle
            acidification is necessary for such intracellular processes as
            protein sorting, zymogen activation, receptor-mediated endocytosis,
            and synaptic vesicle proton gradient generation. V-ATPase is
            composed of a cytosolic V1 domain and a transmembrane V0 domain.
            The V1 domain consists of three A and three B subunits, two G
            subunits plus the C, D, E, F, and H subunits. The V1 domain
            contains the ATP catalytic site. The V0 domain consists of five
            different subunits: a, c, c', c'' and d. Additional isoforms of
            many of the V1 and V0 subunit proteins are encoded by multiple
            genes or alternatively spliced transcript variants. This gene
            encodes one of three G subunit proteins. Transcript variants
            encoding different isoforms have been found for this gene.
            [provided by RefSeq, Jul 2008].
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BX114684.1, CB046058.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA1970526, SAMEA2145774
                                           [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            MANE Ensembl match     :: ENST00000367382.6/ ENSP00000356352.2
            RefSeq Select criteria :: based on conservation, expression
            ##RefSeq-Attributes-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-4                 AI791754.1         15-18
            5-437               BC101130.1         1-433
            438-556             BF509031.1         14-132              c
FEATURES             Location/Qualifiers
     source          1..556
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="1"
                     /map="1q31.3"
     gene            1..556
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /note="ATPase H+ transporting V1 subunit G3"
                     /db_xref="GeneID:127124"
                     /db_xref="HGNC:HGNC:18265"
                     /db_xref="MIM:618071"
     exon            1..112
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /inference="alignment:Splign:2.1.0"
     variation       6
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1306527170"
     variation       9
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:762421187"
     variation       13
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1313145902"
     variation       14
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1660312368"
     variation       16
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1245578690"
     variation       22
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1355518046"
     variation       24
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:774988256"
     variation       27
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:763581571"
     variation       29
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1389547265"
     CDS             31..387
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /EC_number="7.1.2.2"
                     /note="isoform a is encoded by transcript variant 4;
                     ATPase, H+ transporting, lysosomal (vacuolar proton pump)
                     subunit G3; vacuolar proton pump, subunit G3; V-ATPase G3
                     subunit; vacuolar ATP synthase subunit G 3; V-ATPase G
                     subunit 3; vacuolar proton pump G subunit 3; V-ATPase 13
                     kDa subunit 3; V-type proton ATPase subunit G 3; V-ATPase
                     subunit G 3; vacuolar proton pump subunit G 3; ATPase, H+
                     transporting, lysosomal 13kDa, V1 subunit G3"
                     /codon_start=1
                     /product="V-type proton ATPase subunit G 3 isoform a"
                     /protein_id="NP_001363790.1"
                     /db_xref="CCDS:CCDS1395.1"
                     /db_xref="GeneID:127124"
                     /db_xref="HGNC:HGNC:18265"
                     /db_xref="MIM:618071"
                     /translation="
MTSQSQGIHQLLQAEKRAKDKLEEAKKRKGKRLKQAKEEAMVEIDQYRMQRDKEFRLKQSKIMGSQNNLSDEIEEQTLGKIQELNGHYNKYMESVMNQLLSMVCDMKPEIHVNYRATN"
     misc_feature    31..132
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /note="propagated from UniProtKB/Swiss-Prot (Q96LB4.1);
                     Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
     misc_feature    37..351
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /note="Vacuolar (H+)-ATPase G subunit; Region: V-ATPase_G;
                     pfam03179"
                     /db_xref="CDD:427183"
     variation       32
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:762497386"
     variation       33
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:775057499"
     variation       35
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:769509249"
     variation       39
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:184813174"
     variation       42
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:371673303"
     variation       46
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:867256545"
     variation       47
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:747013252"
     variation       48
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1660309784"
     variation       49
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1379432056"
     variation       51
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:777656108"
     variation       52
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:755062618"
     variation       56..65
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace=""
                     /replace="accagcttct"
                     /db_xref="dbSNP:1660308093"
     variation       58
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1334703053"
     variation       60
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:774570397"
     variation       64
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:930668124"
     variation       68
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:779954548"
     variation       69
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:756361136"
     variation       70
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1660307687"
     variation       74
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1660307555"
     variation       79
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:145635563"
     variation       80
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:77891982"
     variation       84
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:757695000"
     variation       94
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1357341284"
     variation       96
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1474694353"
     variation       97
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1660306435"
     variation       99
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:752155821"
     variation       104
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1660306148"
     variation       105
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2103149074"
     variation       108
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1236657850"
     variation       110
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1660305816"
     variation       112
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:974436768"
     exon            113..213
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /inference="alignment:Splign:2.1.0"
     variation       113
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1342309127"
     variation       117
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1299331279"
     variation       119
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1243392718"
     variation       123
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:753377928"
     variation       124
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:765804703"
     variation       125
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:74134730"
     variation       127
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:750027154"
     variation       132
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1326889691"
     variation       140
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1409418665"
     variation       141
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1371294574"
     variation       144
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1170701098"
     variation       148
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1055306745"
     variation       151
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1443078628"
     variation       153
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:767409849"
     variation       155
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:761484574"
     variation       161
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:150515999"
     variation       165
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:764153833"
     variation       166
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1659784983"
     variation       167
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:762948526"
     variation       168
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1483090462"
     variation       169
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:977732012"
     variation       176
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1659783628"
     variation       182
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:948239862"
     variation       184..198
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="ga"
                     /replace="gataaagagtttcga"
                     /db_xref="dbSNP:1381846888"
     variation       186
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1219714753"
     variation       187..189
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="a"
                     /replace="aaa"
                     /db_xref="dbSNP:772670148"
     variation       189
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1333521167"
     variation       190
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:16843254"
     variation       192
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1358303424"
     variation       196
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:776856347"
     variation       197
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1229280482"
     variation       200
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:771076797"
     variation       201
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:747315950"
     variation       202
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:773304511"
     variation       203
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1659781218"
     variation       204
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1659781095"
     variation       205
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1309937250"
     variation       207
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:772534862"
     variation       208
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:376149640"
     variation       209
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1659780470"
     variation       211
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:755475418"
     exon            214..556
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /inference="alignment:Splign:2.1.0"
     variation       214
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:879766724"
     variation       221
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1484689236"
     variation       222
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:184819872"
     variation       224
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:780505562"
     variation       237
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1659533569"
     variation       240..242
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="a"
                     /replace="aga"
                     /db_xref="dbSNP:1659533374"
     variation       243
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1194350517"
     variation       244
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2103128317"
     variation       248
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1346683015"
     variation       251
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1465666337"
     variation       252
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:755700313"
     variation       254..261
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="aaca"
                     /replace="aacaaaca"
                     /db_xref="dbSNP:1271872032"
     variation       255..257
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="a"
                     /replace="aca"
                     /db_xref="dbSNP:1659532017"
     variation       256
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:745394093"
     variation       259
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:112576263"
     variation       260
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1302079609"
     variation       262
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1266446644"
     variation       265..267
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="gg"
                     /replace="ggg"
                     /db_xref="dbSNP:1319597756"
     variation       266
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:756864302"
     variation       267
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:777772213"
     variation       271
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:112568629"
     variation       272
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1390621616"
     variation       273
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:377749734"
     variation       280
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1334591265"
     variation       283
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1558174172"
     variation       285
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:765286199"
     variation       287
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:759475189"
     variation       292
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:750469568"
     variation       296
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:767571258"
     variation       298
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1659528452"
     variation       299
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:761997831"
     variation       300
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:774551191"
     variation       301
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1188865479"
     variation       303
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1450468256"
     variation       311
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1220595588"
     variation       312
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1250368573"
     variation       317
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1202259334"
     variation       319..320
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="aa"
                     /replace="aaa"
                     /db_xref="dbSNP:1558174109"
     variation       321
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:769046951"
     variation       322
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1659526260"
     variation       324..326
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace=""
                     /replace="gct"
                     /db_xref="dbSNP:1256614981"
     variation       324
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:143795532"
     variation       325
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:763283835"
     variation       330..337
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace=""
                     /replace="gagcatgg"
                     /db_xref="dbSNP:1367084288"
     variation       331
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:775784481"
     variation       332
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:770235507"
     variation       333
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1571710627"
     variation       335
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:746320113"
     variation       337
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:373414043"
     variation       343
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:944996834"
     variation       346
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:138693600"
     variation       347
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1659522834"
     variation       348
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1395322838"
     variation       351
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1402845242"
     variation       352
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2103128096"
     variation       361
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1304557759"
     variation       362
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1659522109"
     variation       363
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1460009188"
     variation       370
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1369465257"
     variation       374
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1306277172"
     variation       376
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:903166782"
     variation       377
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:538283202"
     variation       383
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1431260001"
     variation       384
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:542842352"
     variation       389
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:758073073"
     variation       392
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:752568625"
     variation       394
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:778698840"
     variation       395
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1184161003"
     variation       396..399
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="ca"
                     /replace="caca"
                     /db_xref="dbSNP:780883411"
     variation       398
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:946766280"
     variation       400
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1558173955"
     variation       401..402
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace=""
                     /replace="aaaa"
                     /db_xref="dbSNP:1274097003"
     variation       402..405
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace=""
                     /replace="tttc"
                     /db_xref="dbSNP:1344593910"
     variation       405
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1206050747"
     variation       408
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:572126012"
     variation       409..417
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="aaaaaaa"
                     /replace="aaaaaaaa"
                     /replace="aaaaaaaaa"
                     /replace="aaaaaaaaaa"
                     /db_xref="dbSNP:746211686"
     variation       409
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1659519622"
     variation       411
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1659519530"
     variation       412
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1659519435"
     variation       413..420
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="aaaaaggt"
                     /replace="aaaaaggtaaaaaggt"
                     /db_xref="dbSNP:1659518436"
     variation       413
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1243829892"
     variation       414
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1659519226"
     variation       415
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:753801103"
     variation       417
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:915362328"
     variation       418
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:914765045"
     variation       419
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:767559300"
     variation       420
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1314758853"
     variation       421
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1433510401"
     variation       425
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1389673291"
     variation       428
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:761849245"
     variation       429
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:751825875"
     variation       432
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1209455039"
     variation       435
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:764325098"
     variation       436
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:763123368"
     variation       437
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:374367261"
     variation       438..451
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="ttgcttatggcttc"
                     /replace="ttgcttatggcttcttgcttatggcttc"
                     /db_xref="dbSNP:1659516301"
     variation       438
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:373064078"
     variation       441
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:1659516917"
     variation       441
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1659516757"
     variation       445
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1659516620"
     variation       447
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2103127940"
     variation       450
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1659516477"
     variation       451
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1393749416"
     variation       452
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:192406637"
     variation       454
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1055160"
     variation       457
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1221460042"
     variation       461
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1558173848"
     variation       464
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1659515077"
     variation       478
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1466382950"
     variation       479
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:923034432"
     variation       483
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1659514605"
     variation       484
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1316753252"
     variation       485
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:971365911"
     variation       490
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1483264731"
     variation       492
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1659514064"
     variation       496
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1659513959"
     variation       497
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1220019221"
     variation       498
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:375682093"
     variation       508
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2103127891"
     variation       513
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:991319181"
     variation       514
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1659513477"
     variation       518
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1230954677"
     variation       524
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:951792764"
     variation       525
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:555692844"
     variation       527
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:993213516"
     variation       528
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:534514081"
     variation       529
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1259486474"
     variation       530
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1659512632"
     variation       531
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:537568795"
     variation       532
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:762617870"
     variation       535
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1659512282"
     variation       539..545
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="aaa"
                     /replace="aaacaaa"
                     /db_xref="dbSNP:1274894417"
     variation       539
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:187639981"
     regulatory      540..545
                     /regulatory_class="polyA_signal_sequence"
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /note="hexamer: AACAAA"
     variation       541
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1659512085"
     variation       546
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1417442261"
     variation       555
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:555025821"
     polyA_site      556
                     /gene="ATP6V1G3"
                     /gene_synonym="ATP6G3; Vma10"
                     /note="major polyA site"
ORIGIN      
acagaagccacttgcttggagcagactaccatgacaagccagtctcaggggatccaccagcttcttcaggcagaaaaacgggccaaggacaagctagaggaagccaagaagagaaaaggaaagcgattgaagcaagccaaggaggaagcaatggtagaaattgaccagtacagaatgcagagagataaagagtttcgactaaaacaatctaagataatgggctctcagaataatctctcagatgaaatagaagaacaaacactagggaagatacaagaacttaatggacactacaataagtatatggaaagtgtgatgaaccagctcttgagcatggtctgtgacatgaaaccagaaatccatgtgaactacagagccaccaactaaatgtacatcacagttttcaagaaaaaaaaaggtgtgtgagtgccacctggttgcttatggcttcgtatttttatgttgagaaatttgaaatgagaaccttaaatttacatttacaggaaatgtgacataactcatacatcggcactgaattaaacaaaacaaaatacaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]