GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-04-30 19:53:00, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       NM_001320962            1172 bp    mRNA    linear   PRI 23-DEC-2022
DEFINITION  Homo sapiens testis specific protein Y-linked 10 (TSPY10),
            transcript variant 2, mRNA.
ACCESSION   NM_001320962 XM_002344198
VERSION     NM_001320962.1
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1172)
  AUTHORS   Luck K, Kim DK, Lambourne L, Spirohn K, Begg BE, Bian W, Brignall
            R, Cafarelli T, Campos-Laborie FJ, Charloteaux B, Choi D, Cote AG,
            Daley M, Deimling S, Desbuleux A, Dricot A, Gebbia M, Hardy MF,
            Kishore N, Knapp JJ, Kovacs IA, Lemmens I, Mee MW, Mellor JC,
            Pollis C, Pons C, Richardson AD, Schlabach S, Teeking B, Yadav A,
            Babor M, Balcha D, Basha O, Bowman-Colin C, Chin SF, Choi SG,
            Colabella C, Coppin G, D'Amata C, De Ridder D, De Rouck S,
            Duran-Frigola M, Ennajdaoui H, Goebels F, Goehring L, Gopal A,
            Haddad G, Hatchi E, Helmy M, Jacob Y, Kassa Y, Landini S, Li R, van
            Lieshout N, MacWilliams A, Markey D, Paulson JN, Rangarajan S,
            Rasla J, Rayhan A, Rolland T, San-Miguel A, Shen Y, Sheykhkarimli
            D, Sheynkman GM, Simonovsky E, Tasan M, Tejeda A, Tropepe V,
            Twizere JC, Wang Y, Weatheritt RJ, Weile J, Xia Y, Yang X,
            Yeger-Lotem E, Zhong Q, Aloy P, Bader GD, De Las Rivas J, Gaudet S,
            Hao T, Rak J, Tavernier J, Hill DE, Vidal M, Roth FP and Calderwood
            MA.
  TITLE     A reference map of the human binary protein interactome
  JOURNAL   Nature 580 (7803), 402-408 (2020)
   PUBMED   32296183
REFERENCE   2  (bases 1 to 1172)
  AUTHORS   Skaletsky H, Kuroda-Kawaguchi T, Minx PJ, Cordum HS, Hillier L,
            Brown LG, Repping S, Pyntikova T, Ali J, Bieri T, Chinwalla A,
            Delehaunty A, Delehaunty K, Du H, Fewell G, Fulton L, Fulton R,
            Graves T, Hou SF, Latrielle P, Leonard S, Mardis E, Maupin R,
            McPherson J, Miner T, Nash W, Nguyen C, Ozersky P, Pepin K, Rock S,
            Rohlfing T, Scott K, Schultz B, Strong C, Tin-Wollam A, Yang SP,
            Waterston RH, Wilson RK, Rozen S and Page DC.
  TITLE     The male-specific region of the human Y chromosome is a mosaic of
            discrete sequence classes
  JOURNAL   Nature 423 (6942), 825-837 (2003)
   PUBMED   12815422
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            AC006156.5.
            
            On Mar 10, 2016 this sequence version replaced XM_002344198.6.
            
            Sequence Note: The RefSeq transcript and protein were derived from
            genomic sequence to make the sequence consistent with the reference
            genome assembly. The genomic coordinates used for the transcript
            record were based on alignments.
            
            ##Evidence-Data-START##
            Transcript exon combination :: AY130858.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA1968968, SAMEA2148093
                                           [ECO:0000348]
            ##Evidence-Data-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-532               AC006156.5         74167-74698
            533-610             AC006156.5         75306-75383
            611-722             AC006156.5         75512-75623
            723-868             AC006156.5         75725-75870
            869-961             AC006156.5         75966-76058
            962-1172            AC006156.5         76753-76963
FEATURES             Location/Qualifiers
     source          1..1172
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="Y"
                     /map="Yp11.2"
     gene            1..1172
                     /gene="TSPY10"
                     /gene_synonym="CT78; TSPY; TSPY1; TSPY3"
                     /note="testis specific protein Y-linked 10"
                     /db_xref="GeneID:100289087"
                     /db_xref="HGNC:HGNC:37473"
     exon            1..532
                     /gene="TSPY10"
                     /gene_synonym="CT78; TSPY; TSPY1; TSPY3"
                     /inference="alignment:Splign:2.1.0"
     variation       38
                     /gene="TSPY10"
                     /gene_synonym="CT78; TSPY; TSPY1; TSPY3"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1556185297"
     CDS             47..931
                     /gene="TSPY10"
                     /gene_synonym="CT78; TSPY; TSPY1; TSPY3"
                     /note="isoform 2 is encoded by transcript variant 2;
                     Testis-specific Y-encoded protein 3; Testis-specific
                     Y-encoded protein 1; Cancer/testis antigen 78"
                     /codon_start=1
                     /product="testis-specific Y-encoded protein 10 isoform 2"
                     /protein_id="NP_001307891.1"
                     /db_xref="CCDS:CCDS83519.1"
                     /db_xref="GeneID:100289087"
                     /db_xref="HGNC:HGNC:37473"
                     /translation="
MRPEGSLTYRVPERLRQGFCGVGRAAQALVCASAKEGTAFRMEAVQEGAAGVESEQAALGEEAVLLLDDIMAEVEVVAEEEGLVERREEAQRAQQAVPGPGPMTPESALEELLAVQVELEPVNAQARKAFSRQREKMERRRKPHLDRRGAVIQSVPGFWANVIANHPQMSALITDEDEDMLSYMVSLEVEEEKHPVHLCKIMLFFRSNPYFQNKVITKEYLVNITEYRASHSTPIEWYPDYEVEAYRRRHHNSSLNFFNWFSDHNFAGSNKIAESPDRSYVRTCGAIPCNTTRG"
     misc_feature    353..>865
                     /gene="TSPY10"
                     /gene_synonym="CT78; TSPY; TSPY1; TSPY3"
                     /note="Nucleosome assembly protein (NAP); Region: NAP;
                     cl08298"
                     /db_xref="CDD:447601"
     variation       73
                     /gene="TSPY10"
                     /gene_synonym="CT78; TSPY; TSPY1; TSPY3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1556185309"
     variation       151
                     /gene="TSPY10"
                     /gene_synonym="CT78; TSPY; TSPY1; TSPY3"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1603145591"
     variation       258..284
                     /gene="TSPY10"
                     /gene_synonym="CT78; TSPY; TSPY1; TSPY3"
                     /replace="tggcggaggtggaggtggtggcggagg"
                     /replace="tggcggaggtggaggtggtggcggaggtggaggtggtggcggagg"
                     /db_xref="dbSNP:1569407053"
     variation       267
                     /gene="TSPY10"
                     /gene_synonym="CT78; TSPY; TSPY1; TSPY3"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1603145604"
     variation       273
                     /gene="TSPY10"
                     /gene_synonym="CT78; TSPY; TSPY1; TSPY3"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1603145607"
     variation       309
                     /gene="TSPY10"
                     /gene_synonym="CT78; TSPY; TSPY1; TSPY3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1603145614"
     variation       312
                     /gene="TSPY10"
                     /gene_synonym="CT78; TSPY; TSPY1; TSPY3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1603145619"
     variation       372
                     /gene="TSPY10"
                     /gene_synonym="CT78; TSPY; TSPY1; TSPY3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1353461329"
     variation       437
                     /gene="TSPY10"
                     /gene_synonym="CT78; TSPY; TSPY1; TSPY3"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1556185323"
     variation       460
                     /gene="TSPY10"
                     /gene_synonym="CT78; TSPY; TSPY1; TSPY3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1556185338"
     variation       478
                     /gene="TSPY10"
                     /gene_synonym="CT78; TSPY; TSPY1; TSPY3"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1401946011"
     variation       485
                     /gene="TSPY10"
                     /gene_synonym="CT78; TSPY; TSPY1; TSPY3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1556185358"
     variation       496
                     /gene="TSPY10"
                     /gene_synonym="CT78; TSPY; TSPY1; TSPY3"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1603145631"
     exon            533..610
                     /gene="TSPY10"
                     /gene_synonym="CT78; TSPY; TSPY1; TSPY3"
                     /inference="alignment:Splign:2.1.0"
     variation       536
                     /gene="TSPY10"
                     /gene_synonym="CT78; TSPY; TSPY1; TSPY3"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1278882587"
     variation       572..582
                     /gene="TSPY10"
                     /gene_synonym="CT78; TSPY; TSPY1; TSPY3"
                     /replace="gaaga"
                     /replace="gaagatgaaga"
                     /db_xref="dbSNP:775696224"
     exon            611..722
                     /gene="TSPY10"
                     /gene_synonym="CT78; TSPY; TSPY1; TSPY3"
                     /inference="alignment:Splign:2.1.0"
     variation       615
                     /gene="TSPY10"
                     /gene_synonym="CT78; TSPY; TSPY1; TSPY3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1603145682"
     exon            723..868
                     /gene="TSPY10"
                     /gene_synonym="CT78; TSPY; TSPY1; TSPY3"
                     /inference="alignment:Splign:2.1.0"
     variation       728
                     /gene="TSPY10"
                     /gene_synonym="CT78; TSPY; TSPY1; TSPY3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1225448270"
     variation       757
                     /gene="TSPY10"
                     /gene_synonym="CT78; TSPY; TSPY1; TSPY3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1556185436"
     variation       785
                     /gene="TSPY10"
                     /gene_synonym="CT78; TSPY; TSPY1; TSPY3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1556185448"
     variation       852
                     /gene="TSPY10"
                     /gene_synonym="CT78; TSPY; TSPY1; TSPY3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1556185461"
     exon            869..961
                     /gene="TSPY10"
                     /gene_synonym="CT78; TSPY; TSPY1; TSPY3"
                     /inference="alignment:Splign:2.1.0"
     variation       957
                     /gene="TSPY10"
                     /gene_synonym="CT78; TSPY; TSPY1; TSPY3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1276818797"
     exon            962..1172
                     /gene="TSPY10"
                     /gene_synonym="CT78; TSPY; TSPY1; TSPY3"
                     /inference="alignment:Splign:2.1.0"
     variation       968
                     /gene="TSPY10"
                     /gene_synonym="CT78; TSPY; TSPY1; TSPY3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:746060619"
     variation       1030
                     /gene="TSPY10"
                     /gene_synonym="CT78; TSPY; TSPY1; TSPY3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1556185515"
     variation       1072..1073
                     /gene="TSPY10"
                     /gene_synonym="CT78; TSPY; TSPY1; TSPY3"
                     /replace="tt"
                     /replace="ttt"
                     /db_xref="dbSNP:1393550796"
     variation       1075
                     /gene="TSPY10"
                     /gene_synonym="CT78; TSPY; TSPY1; TSPY3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2124357100"
     variation       1097
                     /gene="TSPY10"
                     /gene_synonym="CT78; TSPY; TSPY1; TSPY3"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:372116142"
     regulatory      1155..1160
                     /regulatory_class="polyA_signal_sequence"
                     /gene="TSPY10"
                     /gene_synonym="CT78; TSPY; TSPY1; TSPY3"
                     /note="hexamer: AATAAA"
     polyA_site      1172
                     /gene="TSPY10"
                     /gene_synonym="CT78; TSPY; TSPY1; TSPY3"
                     /note="major polyA site"
ORIGIN      
ggcccttcgcgcgcagtcccttagggggcgcctggaagcccggcgcatgcgccctgagggctcgctgacctaccgggtgccagagaggctgcggcagggtttctgtggcgtgggtcgggcagcacaggccttggtgtgtgcgagtgccaaggagggcaccgccttcaggatggaggctgtacaggagggggcggccggggtggagagtgagcaggcggctttgggggaggaggcggtgctgctgttggatgacataatggcggaggtggaggtggtggcggaggaggagggcctcgtggagcggcgggaggaggcccagcgggcacagcaggctgtgcctggccctgggcccatgaccccagagtctgcactggaggagctgctggccgttcaggtggagctggagccggttaatgcccaagccaggaaggccttttctcggcagcgggaaaagatggagcggaggcgcaagccccacctagaccgcagaggcgccgtcatccagagcgtccctggcttctgggccaatgttattgcaaaccacccccagatgtcagccctgatcactgacgaagatgaagacatgctgagctacatggtcagcctggaggtggaagaagagaagcatcctgttcatctctgcaagatcatgttgttctttcggagtaacccctacttccagaataaagtgattaccaaggaatatctggtgaacatcacagaatacagggcttctcattccactccaattgagtggtatccggattatgaagtggaggcctatcgccgcagacaccacaacagcagccttaacttcttcaactggttctctgaccacaacttcgcaggatctaacaagattgctgagtcccctgacagatcctatgtaaggacctgtggcgcaatcccctgcaatactacaagaggatgaagccacctgaagagggaacagagacgtcaggggactcccagttgttgagttgaatatgatggagcatcagattttacctaatacagcagaactcctaaaaagttacagccatatgcaggacggcagtactcagcatggtcttatgcacaggaactaaaggaaaaacagatcgagtcacaaaaattcaggaagagggggtaaatgtggattgtatggaatgaaaaataaacattctcaagga
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]