2024-05-03 09:57:27, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_001320962 1172 bp mRNA linear PRI 23-DEC-2022 DEFINITION Homo sapiens testis specific protein Y-linked 10 (TSPY10), transcript variant 2, mRNA. ACCESSION NM_001320962 XM_002344198 VERSION NM_001320962.1 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 1172) AUTHORS Luck K, Kim DK, Lambourne L, Spirohn K, Begg BE, Bian W, Brignall R, Cafarelli T, Campos-Laborie FJ, Charloteaux B, Choi D, Cote AG, Daley M, Deimling S, Desbuleux A, Dricot A, Gebbia M, Hardy MF, Kishore N, Knapp JJ, Kovacs IA, Lemmens I, Mee MW, Mellor JC, Pollis C, Pons C, Richardson AD, Schlabach S, Teeking B, Yadav A, Babor M, Balcha D, Basha O, Bowman-Colin C, Chin SF, Choi SG, Colabella C, Coppin G, D'Amata C, De Ridder D, De Rouck S, Duran-Frigola M, Ennajdaoui H, Goebels F, Goehring L, Gopal A, Haddad G, Hatchi E, Helmy M, Jacob Y, Kassa Y, Landini S, Li R, van Lieshout N, MacWilliams A, Markey D, Paulson JN, Rangarajan S, Rasla J, Rayhan A, Rolland T, San-Miguel A, Shen Y, Sheykhkarimli D, Sheynkman GM, Simonovsky E, Tasan M, Tejeda A, Tropepe V, Twizere JC, Wang Y, Weatheritt RJ, Weile J, Xia Y, Yang X, Yeger-Lotem E, Zhong Q, Aloy P, Bader GD, De Las Rivas J, Gaudet S, Hao T, Rak J, Tavernier J, Hill DE, Vidal M, Roth FP and Calderwood MA. TITLE A reference map of the human binary protein interactome JOURNAL Nature 580 (7803), 402-408 (2020) PUBMED 32296183 REFERENCE 2 (bases 1 to 1172) AUTHORS Skaletsky H, Kuroda-Kawaguchi T, Minx PJ, Cordum HS, Hillier L, Brown LG, Repping S, Pyntikova T, Ali J, Bieri T, Chinwalla A, Delehaunty A, Delehaunty K, Du H, Fewell G, Fulton L, Fulton R, Graves T, Hou SF, Latrielle P, Leonard S, Mardis E, Maupin R, McPherson J, Miner T, Nash W, Nguyen C, Ozersky P, Pepin K, Rock S, Rohlfing T, Scott K, Schultz B, Strong C, Tin-Wollam A, Yang SP, Waterston RH, Wilson RK, Rozen S and Page DC. TITLE The male-specific region of the human Y chromosome is a mosaic of discrete sequence classes JOURNAL Nature 423 (6942), 825-837 (2003) PUBMED 12815422 COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from AC006156.5. On Mar 10, 2016 this sequence version replaced XM_002344198.6. Sequence Note: The RefSeq transcript and protein were derived from genomic sequence to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on alignments. ##Evidence-Data-START## Transcript exon combination :: AY130858.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMEA1968968, SAMEA2148093 [ECO:0000348] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end. PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-532 AC006156.5 74167-74698 533-610 AC006156.5 75306-75383 611-722 AC006156.5 75512-75623 723-868 AC006156.5 75725-75870 869-961 AC006156.5 75966-76058 962-1172 AC006156.5 76753-76963 FEATURES Location/Qualifiers source 1..1172 /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="Y" /map="Yp11.2" gene 1..1172 /gene="TSPY10" /gene_synonym="CT78; TSPY; TSPY1; TSPY3" /note="testis specific protein Y-linked 10" /db_xref="GeneID:100289087" /db_xref="HGNC:HGNC:37473" exon 1..532 /gene="TSPY10" /gene_synonym="CT78; TSPY; TSPY1; TSPY3" /inference="alignment:Splign:2.1.0" variation 38 /gene="TSPY10" /gene_synonym="CT78; TSPY; TSPY1; TSPY3" /replace="c" /replace="g" /db_xref="dbSNP:1556185297" CDS 47..931 /gene="TSPY10" /gene_synonym="CT78; TSPY; TSPY1; TSPY3" /note="isoform 2 is encoded by transcript variant 2; Testis-specific Y-encoded protein 3; Testis-specific Y-encoded protein 1; Cancer/testis antigen 78" /codon_start=1 /product="testis-specific Y-encoded protein 10 isoform 2" /protein_id="NP_001307891.1" /db_xref="CCDS:CCDS83519.1" /db_xref="GeneID:100289087" /db_xref="HGNC:HGNC:37473" /translation="
MRPEGSLTYRVPERLRQGFCGVGRAAQALVCASAKEGTAFRMEAVQEGAAGVESEQAALGEEAVLLLDDIMAEVEVVAEEEGLVERREEAQRAQQAVPGPGPMTPESALEELLAVQVELEPVNAQARKAFSRQREKMERRRKPHLDRRGAVIQSVPGFWANVIANHPQMSALITDEDEDMLSYMVSLEVEEEKHPVHLCKIMLFFRSNPYFQNKVITKEYLVNITEYRASHSTPIEWYPDYEVEAYRRRHHNSSLNFFNWFSDHNFAGSNKIAESPDRSYVRTCGAIPCNTTRG"
misc_feature 353..>865 /gene="TSPY10" /gene_synonym="CT78; TSPY; TSPY1; TSPY3" /note="Nucleosome assembly protein (NAP); Region: NAP; cl08298" /db_xref="CDD:447601" variation 73 /gene="TSPY10" /gene_synonym="CT78; TSPY; TSPY1; TSPY3" /replace="c" /replace="t" /db_xref="dbSNP:1556185309" variation 151 /gene="TSPY10" /gene_synonym="CT78; TSPY; TSPY1; TSPY3" /replace="c" /replace="g" /db_xref="dbSNP:1603145591" variation 258..284 /gene="TSPY10" /gene_synonym="CT78; TSPY; TSPY1; TSPY3" /replace="tggcggaggtggaggtggtggcggagg" /replace="tggcggaggtggaggtggtggcggaggtggaggtggtggcggagg" /db_xref="dbSNP:1569407053" variation 267 /gene="TSPY10" /gene_synonym="CT78; TSPY; TSPY1; TSPY3" /replace="g" /replace="t" /db_xref="dbSNP:1603145604" variation 273 /gene="TSPY10" /gene_synonym="CT78; TSPY; TSPY1; TSPY3" /replace="g" /replace="t" /db_xref="dbSNP:1603145607" variation 309 /gene="TSPY10" /gene_synonym="CT78; TSPY; TSPY1; TSPY3" /replace="a" /replace="g" /db_xref="dbSNP:1603145614" variation 312 /gene="TSPY10" /gene_synonym="CT78; TSPY; TSPY1; TSPY3" /replace="a" /replace="g" /db_xref="dbSNP:1603145619" variation 372 /gene="TSPY10" /gene_synonym="CT78; TSPY; TSPY1; TSPY3" /replace="c" /replace="t" /db_xref="dbSNP:1353461329" variation 437 /gene="TSPY10" /gene_synonym="CT78; TSPY; TSPY1; TSPY3" /replace="a" /replace="t" /db_xref="dbSNP:1556185323" variation 460 /gene="TSPY10" /gene_synonym="CT78; TSPY; TSPY1; TSPY3" /replace="a" /replace="g" /db_xref="dbSNP:1556185338" variation 478 /gene="TSPY10" /gene_synonym="CT78; TSPY; TSPY1; TSPY3" /replace="c" /replace="g" /db_xref="dbSNP:1401946011" variation 485 /gene="TSPY10" /gene_synonym="CT78; TSPY; TSPY1; TSPY3" /replace="c" /replace="t" /db_xref="dbSNP:1556185358" variation 496 /gene="TSPY10" /gene_synonym="CT78; TSPY; TSPY1; TSPY3" /replace="c" /replace="g" /db_xref="dbSNP:1603145631" exon 533..610 /gene="TSPY10" /gene_synonym="CT78; TSPY; TSPY1; TSPY3" /inference="alignment:Splign:2.1.0" variation 536 /gene="TSPY10" /gene_synonym="CT78; TSPY; TSPY1; TSPY3" /replace="g" /replace="t" /db_xref="dbSNP:1278882587" variation 572..582 /gene="TSPY10" /gene_synonym="CT78; TSPY; TSPY1; TSPY3" /replace="gaaga" /replace="gaagatgaaga" /db_xref="dbSNP:775696224" exon 611..722 /gene="TSPY10" /gene_synonym="CT78; TSPY; TSPY1; TSPY3" /inference="alignment:Splign:2.1.0" variation 615 /gene="TSPY10" /gene_synonym="CT78; TSPY; TSPY1; TSPY3" /replace="a" /replace="g" /db_xref="dbSNP:1603145682" exon 723..868 /gene="TSPY10" /gene_synonym="CT78; TSPY; TSPY1; TSPY3" /inference="alignment:Splign:2.1.0" variation 728 /gene="TSPY10" /gene_synonym="CT78; TSPY; TSPY1; TSPY3" /replace="a" /replace="g" /db_xref="dbSNP:1225448270" variation 757 /gene="TSPY10" /gene_synonym="CT78; TSPY; TSPY1; TSPY3" /replace="a" /replace="g" /db_xref="dbSNP:1556185436" variation 785 /gene="TSPY10" /gene_synonym="CT78; TSPY; TSPY1; TSPY3" /replace="c" /replace="t" /db_xref="dbSNP:1556185448" variation 852 /gene="TSPY10" /gene_synonym="CT78; TSPY; TSPY1; TSPY3" /replace="c" /replace="t" /db_xref="dbSNP:1556185461" exon 869..961 /gene="TSPY10" /gene_synonym="CT78; TSPY; TSPY1; TSPY3" /inference="alignment:Splign:2.1.0" variation 957 /gene="TSPY10" /gene_synonym="CT78; TSPY; TSPY1; TSPY3" /replace="a" /replace="g" /db_xref="dbSNP:1276818797" exon 962..1172 /gene="TSPY10" /gene_synonym="CT78; TSPY; TSPY1; TSPY3" /inference="alignment:Splign:2.1.0" variation 968 /gene="TSPY10" /gene_synonym="CT78; TSPY; TSPY1; TSPY3" /replace="c" /replace="t" /db_xref="dbSNP:746060619" variation 1030 /gene="TSPY10" /gene_synonym="CT78; TSPY; TSPY1; TSPY3" /replace="a" /replace="g" /db_xref="dbSNP:1556185515" variation 1072..1073 /gene="TSPY10" /gene_synonym="CT78; TSPY; TSPY1; TSPY3" /replace="tt" /replace="ttt" /db_xref="dbSNP:1393550796" variation 1075 /gene="TSPY10" /gene_synonym="CT78; TSPY; TSPY1; TSPY3" /replace="c" /replace="t" /db_xref="dbSNP:2124357100" variation 1097 /gene="TSPY10" /gene_synonym="CT78; TSPY; TSPY1; TSPY3" /replace="c" /replace="g" /db_xref="dbSNP:372116142" regulatory 1155..1160 /regulatory_class="polyA_signal_sequence" /gene="TSPY10" /gene_synonym="CT78; TSPY; TSPY1; TSPY3" /note="hexamer: AATAAA" polyA_site 1172 /gene="TSPY10" /gene_synonym="CT78; TSPY; TSPY1; TSPY3" /note="major polyA site" ORIGIN
ggcccttcgcgcgcagtcccttagggggcgcctggaagcccggcgcatgcgccctgagggctcgctgacctaccgggtgccagagaggctgcggcagggtttctgtggcgtgggtcgggcagcacaggccttggtgtgtgcgagtgccaaggagggcaccgccttcaggatggaggctgtacaggagggggcggccggggtggagagtgagcaggcggctttgggggaggaggcggtgctgctgttggatgacataatggcggaggtggaggtggtggcggaggaggagggcctcgtggagcggcgggaggaggcccagcgggcacagcaggctgtgcctggccctgggcccatgaccccagagtctgcactggaggagctgctggccgttcaggtggagctggagccggttaatgcccaagccaggaaggccttttctcggcagcgggaaaagatggagcggaggcgcaagccccacctagaccgcagaggcgccgtcatccagagcgtccctggcttctgggccaatgttattgcaaaccacccccagatgtcagccctgatcactgacgaagatgaagacatgctgagctacatggtcagcctggaggtggaagaagagaagcatcctgttcatctctgcaagatcatgttgttctttcggagtaacccctacttccagaataaagtgattaccaaggaatatctggtgaacatcacagaatacagggcttctcattccactccaattgagtggtatccggattatgaagtggaggcctatcgccgcagacaccacaacagcagccttaacttcttcaactggttctctgaccacaacttcgcaggatctaacaagattgctgagtcccctgacagatcctatgtaaggacctgtggcgcaatcccctgcaatactacaagaggatgaagccacctgaagagggaacagagacgtcaggggactcccagttgttgagttgaatatgatggagcatcagattttacctaatacagcagaactcctaaaaagttacagccatatgcaggacggcagtactcagcatggtcttatgcacaggaactaaaggaaaaacagatcgagtcacaaaaattcaggaagagggggtaaatgtggattgtatggaatgaaaaataaacattctcaagga
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]