LOCUS       NM_001285987            2075 bp    mRNA    linear   PRI 25-DEC-2023
DEFINITION  Homo sapiens POU class 5 homeobox 1 (POU5F1), transcript variant 5,
            mRNA.
ACCESSION   NM_001285987
VERSION     NM_001285987.1
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 2075)
  AUTHORS   Hong L, Hong S and Zhang X.
  TITLE     Expression and Functional Analysis of core stemness factors OSKM
            (OCT4, SOX2, KLF4, and MYC) in Pan-cancer
  JOURNAL   Medicine (Baltimore) 102 (48), e36433 (2023)
   PUBMED   38050242
  REMARK    GeneRIF: Expression and Functional Analysis of core stemness
            factors OSKM (OCT4, SOX2, KLF4, and MYC) in Pan-cancer.
REFERENCE   2  (bases 1 to 2075)
  AUTHORS   Panayiotou T, Eftychiou M, Patera E, Promponas VJ and Strati K.
  TITLE     A paradigm for post-embryonic Oct4 re-expression: E7-induced
            hydroxymethylation regulates Oct4 expression in cervical cancer
  JOURNAL   J Med Virol 95 (12), e29264 (2023)
   PUBMED   38054553
  REMARK    GeneRIF: A paradigm for post-embryonic Oct4 re-expression:
            E7-induced hydroxymethylation regulates Oct4 expression in cervical
            cancer.
REFERENCE   3  (bases 1 to 2075)
  AUTHORS   Wang X and Dai J.
  TITLE     Concise review: isoforms of OCT4 contribute to the confusing
            diversity in stem cell biology
  JOURNAL   Stem Cells 28 (5), 885-893 (2010)
   PUBMED   20333750
  REMARK    GeneRIF: This review article underscores the importance of
            identifying and discriminating the expression and functions of OCT4
            isoforms in stem cell research.
            Review article
REFERENCE   4  (bases 1 to 2075)
  AUTHORS   Zhang W, Wang X, Xiao Z, Liu W, Chen B and Dai J.
  TITLE     Mapping of the minimal internal ribosome entry site element in the
            human embryonic stem cell gene OCT4B mRNA
  JOURNAL   Biochem Biophys Res Commun 394 (3), 750-754 (2010)
   PUBMED   20230781
  REMARK    GeneRIF: a 30-nt sequence (nt 201-231), which is sufficient to
            promote internal initiation of translation of OCT4B mRNA in
            embryonic stem cells was mapped.
REFERENCE   5  (bases 1 to 2075)
  AUTHORS   Wang X, Zhao Y, Xiao Z, Chen B, Wei Z, Wang B, Zhang J, Han J, Gao
            Y, Li L, Zhao H, Zhao W, Lin H and Dai J.
  TITLE     Alternative translation of OCT4 by an internal ribosome entry site
            and its novel function in stress response
  JOURNAL   Stem Cells 27 (6), 1265-1275 (2009)
   PUBMED   19489092
  REMARK    GeneRIF: OCT4 gene, by the regulation of alternative splicing and
            alternative translation initiation, may carry out more crucial
            roles in many biological events.
            GeneRIF: Shows that isoform OCT4B-190 initiates at a non-AUG (CUG)
            translation initiation codon.
REFERENCE   6  (bases 1 to 2075)
  AUTHORS   Atlasi Y, Mowla SJ, Ziaee SA, Gokhale PJ and Andrews PW.
  TITLE     OCT4 spliced variants are differentially expressed in human
            pluripotent and nonpluripotent cells
  JOURNAL   Stem Cells 26 (12), 3068-3074 (2008)
   PUBMED   18787205
  REMARK    GeneRIF: OCT4 spliced variants are differentially expressed in
            human pluripotent and nonpluripotent cells
REFERENCE   7  (bases 1 to 2075)
  AUTHORS   Lee J, Kim HK, Rho JY, Han YM and Kim J.
  TITLE     The human OCT-4 isoforms differ in their ability to confer
            self-renewal
  JOURNAL   J Biol Chem 281 (44), 33554-33565 (2006)
   PUBMED   16951404
  REMARK    GeneRIF: DNA binding, transactivation, and abilities to confer
            self-renewal of the human OCT-4 isoforms differ
REFERENCE   8  (bases 1 to 2075)
  AUTHORS   Wey E, Lyons GE and Schafer BW.
  TITLE     A human POU domain gene, mPOU, is expressed in developing brain and
            specific adult tissues
  JOURNAL   Eur J Biochem 220 (3), 753-762 (1994)
   PUBMED   7908264
REFERENCE   9  (bases 1 to 2075)
  AUTHORS   Takeda J, Seino S and Bell GI.
  TITLE     Human Oct3 gene family: cDNA sequences, alternative splicing, gene
            organization, chromosomal location, and expression at low levels in
            adult tissues
  JOURNAL   Nucleic Acids Res 20 (17), 4613-4620 (1992)
   PUBMED   1408763
REFERENCE   10 (bases 1 to 2075)
  AUTHORS   Schoorlemmer J and Kruijer W.
  TITLE     Octamer-dependent regulation of the kFGF gene in embryonal
            carcinoma and embryonic stem cells
  JOURNAL   Mech Dev 36 (1-2), 75-86 (1991)
   PUBMED   1723621
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from DQ486514.1, DQ486515.1,
            Z11899.1 and AI811039.1.
            
            Summary: This gene encodes a transcription factor containing a POU
            homeodomain that plays a key role in embryonic development and stem
            cell pluripotency. Aberrant expression of this gene in adult
            tissues is associated with tumorigenesis. This gene can participate
            in a translocation with the Ewing's sarcoma gene on chromosome 21,
            which also leads to tumor formation. Alternative splicing, as well
            as usage of alternative AUG and non-AUG translation initiation
            codons, results in multiple isoforms. One of the AUG start codons
            is polymorphic in human populations. Related pseudogenes have been
            identified on chromosomes 1, 3, 8, 10, and 12. [provided by RefSeq,
            Oct 2013].
            
            Transcript Variant: This variant (5, also known as OCT4B) differs
            in the 5' UTR, lacks a portion of the 5' coding region, and
            initiates translation at an alternate AUG start codon, compared to
            variant 1. The resulting isoform (3, also known as OCT4B-265) is
            shorter and has a distinct N-terminus, compared to isoform 1. This
            variant represents an allele of variant 2 that contains an AUG
            start codon that is polymorphic in human populations (see
            rs3130932). This variant may encode additional isoforms through the
            use of alternative downstream AUG and non-AUG start codons, as
            described in PMID:19489092.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: KY781166.1, KX151172.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA1968189, SAMEA1968540
                                           [ECO:0000348]
            ##Evidence-Data-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-332               DQ486514.1         1-332
            333-1004            DQ486515.1         1-672
            1005-1681           Z11899.1           103-779
            1682-2051           DQ486515.1         1350-1719
            2052-2075           AI811039.1         1-24                c
FEATURES             Location/Qualifiers
     source          1..2075
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="6"
                     /map="6p21.33"
     gene            1..2075
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /note="POU class 5 homeobox 1"
                     /db_xref="GeneID:5460"
                     /db_xref="HGNC:HGNC:9221"
                     /db_xref="MIM:164177"
     exon            1..1244
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    974..976
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /note="upstream in-frame stop codon"
     CDS             1004..1801
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /note="isoform 3 is encoded by transcript variant 5;
                     POU-type homeodomain-containing DNA-binding protein; POU
                     domain transcription factor OCT4; POU domain, class 5,
                     transcription factor 1; octamer-binding protein 3;
                     octamer-binding protein 4; octamer-binding transcription
                     factor 3"
                     /codon_start=1
                     /product="POU domain, class 5, transcription factor 1
                     isoform 3"
                     /protein_id="NP_001272916.1"
                     /db_xref="GeneID:5460"
                     /db_xref="HGNC:HGNC:9221"
                     /db_xref="MIM:164177"
                     /translation="

MHFYRLFLGATRRFLNPEWKGEIDNWCVYVLTSLLPFKIQSQDIKALQKELEQFAKLLKQKRITLGYTQADVGLTLGVLFGKVFSQTTICRFEALQLSFKNMCKLRPLLQKWVEEADNNENLQEICKAETLVQARKRKRTSIENRVRGNLENLFLQCPKPTLQQISHIAQQLGLEKDVVRVWFCNRRQKGKRSSSDYAQREDFEAAGSPFSGGPVSFPLAPGPHFGTPGYGSPHFTALYSSVPFPEGEAFPPVSVTTLGSPMHSN"

     misc_feature    1130..1354
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /note="Found in Pit-Oct-Unc transcription factors; Region:
                     POU; smart00352"
                     /db_xref="CDD:197673"
     misc_feature    1229..1231
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /note="OCT4B-190; non-AUG start codon; Region: Alternative
                     start codon"
     misc_feature    1307..1309
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /note="OCT4B-164; Region: Alternative start codon"
     misc_feature    order(1409..1423,1427..1429,1478..1480,1496..1498,
                     1535..1537,1541..1546,1553..1558,1562..1570,1574..1579)
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238039"
     misc_feature    1415..1576
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /note="Homeobox domain; Region: Homeobox; pfam00046"
                     /db_xref="CDD:425441"
     misc_feature    order(1415..1417,1424..1426,1544..1546,1553..1558,
                     1565..1567)
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:238039"
     exon            1245..1375
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /inference="alignment:Splign:2.1.0"
     exon            1376..1534
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /inference="alignment:Splign:2.1.0"
     exon            1535..2065
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /inference="alignment:Splign:2.1.0"
     regulatory      2028..2033
                     /regulatory_class="polyA_signal_sequence"
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /note="hexamer: AATAAA"
     polyA_site      2065
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /note="major polyA site"
ORIGIN      

ggaaaaaaggaaagtgcacttggaagagatccaagtgggcaacttgaagaacaagtgccaaatagcacttctgtcatgctggatgtcagggctctttgtccactttgtatagccgctggcttatagaaggtgctcgataaatctcttgaatttaaaaatcaattaggatgcctctatagtgaaaaagatacagtaaagatgagggataatcaatttaaaaaatgagtaagtacacacaaagcactttatccattcttatgacacctgttacttttttgctgtgtttgtgtgtatgcatgccatgttatagtttgtgggaccctcaaagcaagctggggagagtatatactgaatttagcttctgagacatgatgctcttcctttttaattaacccagaacttagcagcttatctatttctctaatctcaaaacatccttaaactgggggtgatacttgagtgagagaattttgcaggtattaaatgaactatcttcttttttttttttctttgagacagagtcttgctctgtcacccaggctggagtgcagtggcgtgatctcagctcactgcaacctccgcctcccgggttcaagtgattctcctgcctcagcctcctgagtagctgggattacaggtgcgtgccaccgtgcccagctaatttttgtgtttttagtagagacggggtttcaccatgttggccatgctggtcttgaactcctgacctcgtgatctgcccacctcggcctcccaaagtgctggaattataggcgtgagccaccgcgcccagcaaagaacttctaaccttcataacctgacaggtgttctcgaggccagggtctctctttctgtcctttcacgatgctctgcatcccttggatgtgccagtttctgggggaagagtagtcctttgttacatgcatgagtcagtgaacagggaatgggtgaatgacatttgtgggtaggttatttctagaagttaggtgggcagcttggaaggcagatgcacttctacagactattccttggggccacacgtaggttcttgaatcccgaatggaaaggggagattgataactggtgtgtttatgttcttacaagtcttctgccttttaaaatccagtcccaggacatcaaagctctgcagaaagaactcgagcaatttgccaagctcctgaagcagaagaggatcaccctgggatatacacaggccgatgtggggctcaccctgggggttctatttgggaaggtattcagccaaacgaccatctgccgctttgaggctctgcagcttagcttcaagaacatgtgtaagctgcggcccttgctgcagaagtgggtggaggaagctgacaacaatgaaaatcttcaggagatatgcaaagcagaaaccctcgtgcaggcccgaaagagaaagcgaaccagtatcgagaaccgagtgagaggcaacctggagaatttgttcctgcagtgcccgaaacccacactgcagcagatcagccacatcgcccagcagcttgggctcgagaaggatgtggtccgagtgtggttctgtaaccggcgccagaagggcaagcgatcaagcagcgactatgcacaacgagaggattttgaggctgctgggtctcctttctcagggggaccagtgtcctttcctctggccccagggccccattttggtaccccaggctatgggagccctcacttcactgcactgtactcctcggtccctttccctgagggggaagcctttccccctgtctccgtcaccactctgggctctcccatgcattcaaactgaggtgcctgcccttctaggaatgggggacagggggaggggaggagctagggaaagaaaacctggagtttgtgccagggtttttgggattaagttcttcattcactaaggaaggaattgggaacacaaagggtgggggcaggggagtttggggcaactggttggagggaaggtgaagttcaatgatgctcttgattttaatcccacatcatgtatcacttttttcttaaataaagaagcctgggacacagtagatagacacacttaaaaaaaaaaa

//