2024-04-26 10:04:52, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_001282469 1161 bp mRNA linear PRI 25-DEC-2022 DEFINITION Homo sapiens testis specific protein Y-linked 10 (TSPY10), transcript variant 1, mRNA. ACCESSION NM_001282469 XM_003403496 VERSION NM_001282469.3 KEYWORDS RefSeq; MANE Select. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 1161) AUTHORS Luck K, Kim DK, Lambourne L, Spirohn K, Begg BE, Bian W, Brignall R, Cafarelli T, Campos-Laborie FJ, Charloteaux B, Choi D, Cote AG, Daley M, Deimling S, Desbuleux A, Dricot A, Gebbia M, Hardy MF, Kishore N, Knapp JJ, Kovacs IA, Lemmens I, Mee MW, Mellor JC, Pollis C, Pons C, Richardson AD, Schlabach S, Teeking B, Yadav A, Babor M, Balcha D, Basha O, Bowman-Colin C, Chin SF, Choi SG, Colabella C, Coppin G, D'Amata C, De Ridder D, De Rouck S, Duran-Frigola M, Ennajdaoui H, Goebels F, Goehring L, Gopal A, Haddad G, Hatchi E, Helmy M, Jacob Y, Kassa Y, Landini S, Li R, van Lieshout N, MacWilliams A, Markey D, Paulson JN, Rangarajan S, Rasla J, Rayhan A, Rolland T, San-Miguel A, Shen Y, Sheykhkarimli D, Sheynkman GM, Simonovsky E, Tasan M, Tejeda A, Tropepe V, Twizere JC, Wang Y, Weatheritt RJ, Weile J, Xia Y, Yang X, Yeger-Lotem E, Zhong Q, Aloy P, Bader GD, De Las Rivas J, Gaudet S, Hao T, Rak J, Tavernier J, Hill DE, Vidal M, Roth FP and Calderwood MA. TITLE A reference map of the human binary protein interactome JOURNAL Nature 580 (7803), 402-408 (2020) PUBMED 32296183 REFERENCE 2 (bases 1 to 1161) AUTHORS Skaletsky H, Kuroda-Kawaguchi T, Minx PJ, Cordum HS, Hillier L, Brown LG, Repping S, Pyntikova T, Ali J, Bieri T, Chinwalla A, Delehaunty A, Delehaunty K, Du H, Fewell G, Fulton L, Fulton R, Graves T, Hou SF, Latrielle P, Leonard S, Mardis E, Maupin R, McPherson J, Miner T, Nash W, Nguyen C, Ozersky P, Pepin K, Rock S, Rohlfing T, Scott K, Schultz B, Strong C, Tin-Wollam A, Yang SP, Waterston RH, Wilson RK, Rozen S and Page DC. TITLE The male-specific region of the human Y chromosome is a mosaic of discrete sequence classes JOURNAL Nature 423 (6942), 825-837 (2003) PUBMED 12815422 COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from BC121114.1 and DB545400.1. On May 17, 2019 this sequence version replaced NM_001282469.2. ##Evidence-Data-START## Transcript exon combination :: BC121114.1, ERR279874.771.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMEA1968968, SAMEA2148093 [ECO:0000348] ##Evidence-Data-END## ##RefSeq-Attributes-START## MANE Ensembl match :: ENST00000428845.6/ ENSP00000406407.2 RefSeq Select criteria :: based on expression, longest protein ##RefSeq-Attributes-END## COMPLETENESS: complete on the 3' end. PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-945 BC121114.1 5-949 946-1161 DB545400.1 280-495 FEATURES Location/Qualifiers source 1..1161 /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="Y" /map="Yp11.2" gene 1..1161 /gene="TSPY10" /gene_synonym="CT78; TSPY; TSPY1; TSPY3" /note="testis specific protein Y-linked 10" /db_xref="GeneID:100289087" /db_xref="HGNC:HGNC:37473" exon 1..532 /gene="TSPY10" /gene_synonym="CT78; TSPY; TSPY1; TSPY3" /inference="alignment:Splign:2.1.0" variation 38 /gene="TSPY10" /gene_synonym="CT78; TSPY; TSPY1; TSPY3" /replace="c" /replace="g" /db_xref="dbSNP:1556185297" CDS 47..973 /gene="TSPY10" /gene_synonym="CT78; TSPY; TSPY1; TSPY3" /note="isoform 1 is encoded by transcript variant 1; Testis-specific Y-encoded protein 3; Testis-specific Y-encoded protein 1; Cancer/testis antigen 78" /codon_start=1 /product="testis-specific Y-encoded protein 10 isoform 1" /protein_id="NP_001269398.1" /db_xref="CCDS:CCDS65365.1" /db_xref="GeneID:100289087" /db_xref="HGNC:HGNC:37473" /translation="
MRPEGSLTYRVPERLRQGFCGVGRAAQALVCASAKEGTAFRMEAVQEGAAGVESEQAALGEEAVLLLDDIMAEVEVVAEEEGLVERREEAQRAQQAVPGPGPMTPESALEELLAVQVELEPVNAQARKAFSRQREKMERRRKPHLDRRGAVIQSVPGFWANVIANHPQMSALITDEDEDMLSYMVSLEVEEEKHPVHLCKIMLFFRSNPYFQNKVITKEYLVNITEYRASHSTPIEWYPDYEVEAYRRRHHNSSLNFFNWFSDHNFAGSNKIAEILCKDLWRNPLQYYKRMKPPEEGTETSGDSQLLS"
misc_feature 422..910 /gene="TSPY10" /gene_synonym="CT78; TSPY; TSPY1; TSPY3" /note="Nucleosome assembly protein (NAP); Region: NAP; cl08298" /db_xref="CDD:447601" variation 73 /gene="TSPY10" /gene_synonym="CT78; TSPY; TSPY1; TSPY3" /replace="c" /replace="t" /db_xref="dbSNP:1556185309" variation 151 /gene="TSPY10" /gene_synonym="CT78; TSPY; TSPY1; TSPY3" /replace="c" /replace="g" /db_xref="dbSNP:1603145591" variation 258..284 /gene="TSPY10" /gene_synonym="CT78; TSPY; TSPY1; TSPY3" /replace="tggcggaggtggaggtggtggcggagg" /replace="tggcggaggtggaggtggtggcggaggtggaggtggtggcggagg" /db_xref="dbSNP:1569407053" variation 267 /gene="TSPY10" /gene_synonym="CT78; TSPY; TSPY1; TSPY3" /replace="g" /replace="t" /db_xref="dbSNP:1603145604" variation 273 /gene="TSPY10" /gene_synonym="CT78; TSPY; TSPY1; TSPY3" /replace="g" /replace="t" /db_xref="dbSNP:1603145607" variation 309 /gene="TSPY10" /gene_synonym="CT78; TSPY; TSPY1; TSPY3" /replace="a" /replace="g" /db_xref="dbSNP:1603145614" variation 312 /gene="TSPY10" /gene_synonym="CT78; TSPY; TSPY1; TSPY3" /replace="a" /replace="g" /db_xref="dbSNP:1603145619" variation 372 /gene="TSPY10" /gene_synonym="CT78; TSPY; TSPY1; TSPY3" /replace="c" /replace="t" /db_xref="dbSNP:1353461329" variation 437 /gene="TSPY10" /gene_synonym="CT78; TSPY; TSPY1; TSPY3" /replace="a" /replace="t" /db_xref="dbSNP:1556185323" variation 460 /gene="TSPY10" /gene_synonym="CT78; TSPY; TSPY1; TSPY3" /replace="a" /replace="g" /db_xref="dbSNP:1556185338" variation 478 /gene="TSPY10" /gene_synonym="CT78; TSPY; TSPY1; TSPY3" /replace="c" /replace="g" /db_xref="dbSNP:1401946011" variation 485 /gene="TSPY10" /gene_synonym="CT78; TSPY; TSPY1; TSPY3" /replace="c" /replace="t" /db_xref="dbSNP:1556185358" variation 496 /gene="TSPY10" /gene_synonym="CT78; TSPY; TSPY1; TSPY3" /replace="c" /replace="g" /db_xref="dbSNP:1603145631" exon 533..610 /gene="TSPY10" /gene_synonym="CT78; TSPY; TSPY1; TSPY3" /inference="alignment:Splign:2.1.0" variation 536 /gene="TSPY10" /gene_synonym="CT78; TSPY; TSPY1; TSPY3" /replace="g" /replace="t" /db_xref="dbSNP:1278882587" variation 572..582 /gene="TSPY10" /gene_synonym="CT78; TSPY; TSPY1; TSPY3" /replace="gaaga" /replace="gaagatgaaga" /db_xref="dbSNP:775696224" exon 611..722 /gene="TSPY10" /gene_synonym="CT78; TSPY; TSPY1; TSPY3" /inference="alignment:Splign:2.1.0" variation 615 /gene="TSPY10" /gene_synonym="CT78; TSPY; TSPY1; TSPY3" /replace="a" /replace="g" /db_xref="dbSNP:1603145682" exon 723..868 /gene="TSPY10" /gene_synonym="CT78; TSPY; TSPY1; TSPY3" /inference="alignment:Splign:2.1.0" variation 728 /gene="TSPY10" /gene_synonym="CT78; TSPY; TSPY1; TSPY3" /replace="a" /replace="g" /db_xref="dbSNP:1225448270" variation 757 /gene="TSPY10" /gene_synonym="CT78; TSPY; TSPY1; TSPY3" /replace="a" /replace="g" /db_xref="dbSNP:1556185436" variation 785 /gene="TSPY10" /gene_synonym="CT78; TSPY; TSPY1; TSPY3" /replace="c" /replace="t" /db_xref="dbSNP:1556185448" variation 852 /gene="TSPY10" /gene_synonym="CT78; TSPY; TSPY1; TSPY3" /replace="c" /replace="t" /db_xref="dbSNP:1556185461" exon 869..950 /gene="TSPY10" /gene_synonym="CT78; TSPY; TSPY1; TSPY3" /inference="alignment:Splign:2.1.0" variation 946 /gene="TSPY10" /gene_synonym="CT78; TSPY; TSPY1; TSPY3" /replace="a" /replace="g" /db_xref="dbSNP:1276818797" exon 951..1161 /gene="TSPY10" /gene_synonym="CT78; TSPY; TSPY1; TSPY3" /inference="alignment:Splign:2.1.0" variation 957 /gene="TSPY10" /gene_synonym="CT78; TSPY; TSPY1; TSPY3" /replace="c" /replace="t" /db_xref="dbSNP:746060619" variation 1019 /gene="TSPY10" /gene_synonym="CT78; TSPY; TSPY1; TSPY3" /replace="a" /replace="g" /db_xref="dbSNP:1556185515" variation 1061..1062 /gene="TSPY10" /gene_synonym="CT78; TSPY; TSPY1; TSPY3" /replace="tt" /replace="ttt" /db_xref="dbSNP:1393550796" variation 1064 /gene="TSPY10" /gene_synonym="CT78; TSPY; TSPY1; TSPY3" /replace="c" /replace="t" /db_xref="dbSNP:2124357100" variation 1086 /gene="TSPY10" /gene_synonym="CT78; TSPY; TSPY1; TSPY3" /replace="c" /replace="g" /db_xref="dbSNP:372116142" regulatory 1144..1149 /regulatory_class="polyA_signal_sequence" /gene="TSPY10" /gene_synonym="CT78; TSPY; TSPY1; TSPY3" /note="hexamer: AATAAA" polyA_site 1161 /gene="TSPY10" /gene_synonym="CT78; TSPY; TSPY1; TSPY3" /note="major polyA site" ORIGIN
ggcccttcgcgcgcagtcccttagggggcgcctggaagcccggcgcatgcgccctgagggctcgctgacctaccgggtgccagagaggctgcggcagggtttctgtggcgtgggtcgggcagcacaggccttggtgtgtgcgagtgccaaggagggcaccgccttcaggatggaggctgtacaggagggggcggccggggtggagagtgagcaggcggctttgggggaggaggcggtgctgctgttggatgacataatggcggaggtggaggtggtggcggaggaggagggcctcgtggagcggcgggaggaggcccagcgggcacagcaggctgtgcctggccctgggcccatgaccccagagtctgcactggaggagctgctggccgttcaggtggagctggagccggttaatgcccaagccaggaaggccttttctcggcagcgggaaaagatggagcggaggcgcaagccccacctagaccgcagaggcgccgtcatccagagcgtccctggcttctgggccaatgttattgcaaaccacccccagatgtcagccctgatcactgacgaagatgaagacatgctgagctacatggtcagcctggaggtggaagaagagaagcatcctgttcatctctgcaagatcatgttgttctttcggagtaacccctacttccagaataaagtgattaccaaggaatatctggtgaacatcacagaatacagggcttctcattccactccaattgagtggtatccggattatgaagtggaggcctatcgccgcagacaccacaacagcagccttaacttcttcaactggttctctgaccacaacttcgcaggatctaacaagattgctgagatcctatgtaaggacctgtggcgcaatcccctgcaatactacaagaggatgaagccacctgaagagggaacagagacgtcaggggactcccagttgttgagttgaatatgatggagcatcagattttacctaatacagcagaactcctaaaaagttacagccatatgcaggacggcagtactcagcatggtcttatgcacaggaactaaaggaaaaacagatcgagtcacaaaaattcaggaagagggggtaaatgtggattgtatggaatgaaaaataaacattctcaagga
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]