ver.2
Home
|
Help
|
Advanced search
Previous release (v1)
2024-04-25 09:11:27, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_001243721 1161 bp mRNA linear PRI 20-APR-2022
DEFINITION Homo sapiens testis specific protein Y-linked 8 (TSPY8), mRNA.
ACCESSION NM_001243721 XM_001127004
VERSION NM_001243721.2
KEYWORDS RefSeq; MANE Select.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 1161)
AUTHORS Skaletsky H, Kuroda-Kawaguchi T, Minx PJ, Cordum HS, Hillier L,
Brown LG, Repping S, Pyntikova T, Ali J, Bieri T, Chinwalla A,
Delehaunty A, Delehaunty K, Du H, Fewell G, Fulton L, Fulton R,
Graves T, Hou SF, Latrielle P, Leonard S, Mardis E, Maupin R,
McPherson J, Miner T, Nash W, Nguyen C, Ozersky P, Pepin K, Rock S,
Rohlfing T, Scott K, Schultz B, Strong C, Tin-Wollam A, Yang SP,
Waterston RH, Wilson RK, Rozen S and Page DC.
TITLE The male-specific region of the human Y chromosome is a mosaic of
discrete sequence classes
JOURNAL Nature 423 (6942), 825-837 (2003)
PUBMED 12815422
COMMENT VALIDATED REFSEQ: This record has undergone validation or
preliminary review. The reference sequence was derived from
AC006158.6.
On Aug 10, 2020 this sequence version replaced NM_001243721.1.
CCDS Note: This CCDS representation lacks full-length human
transcript support and it is therefore inferred, but the
full-length exon combination it is supported by partial human
transcripts (AA608988.1 and DB476671.1) paralogous transcript
U58096.1.
##Evidence-Data-START##
RNAseq introns :: single sample supports all introns SAMEA1968968,
SAMEA2148093 [ECO:0000348]
##Evidence-Data-END##
##RefSeq-Attributes-START##
MANE Ensembl match :: ENST00000287721.13/ ENSP00000287721.9
RefSeq Select criteria :: based on manual assertion, expression,
longest protein
##RefSeq-Attributes-END##
COMPLETENESS: complete on the 3' end.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-532 AC006158.6 64443-64974
533-610 AC006158.6 65582-65659
611-722 AC006158.6 65788-65899
723-868 AC006158.6 66001-66146
869-950 AC006158.6 66253-66334
951-1161 AC006158.6 67029-67239
FEATURES Location/Qualifiers
source 1..1161
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="Y"
/map="Yp11.2"
gene 1..1161
/gene="TSPY8"
/note="testis specific protein Y-linked 8"
/db_xref="GeneID:728403"
/db_xref="HGNC:HGNC:37471"
exon 1..532
/gene="TSPY8"
/inference="alignment:Splign:2.1.0"
variation 23
/gene="TSPY8"
/replace=""
/replace="a"
/db_xref="dbSNP:755556626"
variation 27
/gene="TSPY8"
/replace="a"
/replace="g"
/db_xref="dbSNP:1384648018"
variation 29
/gene="TSPY8"
/replace=""
/replace="c"
/db_xref="dbSNP:779537724"
variation 30
/gene="TSPY8"
/replace="g"
/replace="t"
/db_xref="dbSNP:773869877"
variation 38
/gene="TSPY8"
/replace="c"
/replace="g"
/db_xref="dbSNP:761252400"
variation 42
/gene="TSPY8"
/replace="a"
/replace="g"
/db_xref="dbSNP:767443260"
variation 44
/gene="TSPY8"
/replace="c"
/replace="t"
/db_xref="dbSNP:1283571419"
variation 45
/gene="TSPY8"
/replace="g"
/replace="t"
/db_xref="dbSNP:773125040"
CDS 47..973
/gene="TSPY8"
/codon_start=1
/product="testis-specific Y-encoded protein 8"
/protein_id="NP_001230650.1"
/db_xref="CCDS:CCDS59533.1"
/db_xref="GeneID:728403"
/db_xref="HGNC:HGNC:37471"
/translation="
MRPEGSLTYWVPERLRQGFCGVGRAAQALVCASAKEGTAFRMEAVQEGAAGVESEQAALGEEAVLLLDDIMAEVEVVAEEEGLVERREEAQRAQQAVPGPGPMTPESALEELLAVQVELEPVNAQARKAFSRQREKMERRRKPHLDRRGAVIQSVPGFWANVIANHPQMSALITDEDEDMLSYMVSLEVEEEKHPVHLCKIMLFFRSNPYFQNKVITKEYLVNITEYRASHSTPIEWYLDYEVEAYRRRHHNSSLNFFNWFSDHNFAGSNKIAEILCKDLWRNPLQYYKRMKPPEEGTETSGDSQLLS"
misc_feature 422..910
/gene="TSPY8"
/note="Nucleosome assembly protein (NAP); Region: NAP;
cl08298"
/db_xref="CDD:447601"
variation 47
/gene="TSPY8"
/replace="a"
/replace="g"
/db_xref="dbSNP:2016003059"
variation 50
/gene="TSPY8"
/replace="c"
/replace="t"
/db_xref="dbSNP:1603140079"
variation 54
/gene="TSPY8"
/replace="c"
/replace="g"
/db_xref="dbSNP:760572223"
variation 55
/gene="TSPY8"
/replace="c"
/replace="t"
/db_xref="dbSNP:766059501"
variation 59
/gene="TSPY8"
/replace="g"
/replace="t"
/db_xref="dbSNP:753631588"
variation 60
/gene="TSPY8"
/replace="a"
/replace="g"
/db_xref="dbSNP:758572301"
variation 64
/gene="TSPY8"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:764356240"
variation 65
/gene="TSPY8"
/replace="a"
/replace="c"
/db_xref="dbSNP:757408537"
variation 67
/gene="TSPY8"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:781778860"
variation 70
/gene="TSPY8"
/replace="a"
/replace="c"
/db_xref="dbSNP:1457488245"
variation 73
/gene="TSPY8"
/replace="c"
/replace="t"
/db_xref="dbSNP:756541077"
variation 76
/gene="TSPY8"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:780310523"
variation 77
/gene="TSPY8"
/replace="c"
/replace="g"
/db_xref="dbSNP:749613655"
variation 84
/gene="TSPY8"
/replace="a"
/replace="g"
/db_xref="dbSNP:1556180031"
variation 85
/gene="TSPY8"
/replace=""
/replace="g"
/db_xref="dbSNP:753549902"
variation 88
/gene="TSPY8"
/replace="g"
/replace="t"
/db_xref="dbSNP:768306591"
variation 91
/gene="TSPY8"
/replace="a"
/replace="g"
/db_xref="dbSNP:778466849"
variation 94
/gene="TSPY8"
/replace="a"
/replace="g"
/db_xref="dbSNP:1367283915"
variation 98
/gene="TSPY8"
/replace="g"
/replace="t"
/db_xref="dbSNP:1476646611"
variation 105
/gene="TSPY8"
/replace="a"
/replace="g"
/db_xref="dbSNP:747718289"
variation 110
/gene="TSPY8"
/replace="a"
/replace="g"
/db_xref="dbSNP:1172231287"
variation 113
/gene="TSPY8"
/replace="a"
/replace="g"
/db_xref="dbSNP:771553199"
variation 116
/gene="TSPY8"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:773243424"
variation 181
/gene="TSPY8"
/replace="a"
/replace="g"
/db_xref="dbSNP:387087"
variation 188
/gene="TSPY8"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:1464787539"
variation 230
/gene="TSPY8"
/replace="g"
/replace="t"
/db_xref="dbSNP:1603140150"
variation 358
/gene="TSPY8"
/replace="c"
/replace="t"
/db_xref="dbSNP:1603140154"
variation 437
/gene="TSPY8"
/replace="a"
/replace="t"
/db_xref="dbSNP:1556180134"
variation 460
/gene="TSPY8"
/replace="a"
/replace="g"
/db_xref="dbSNP:1556180143"
variation 478
/gene="TSPY8"
/replace="c"
/replace="g"
/db_xref="dbSNP:1328941043"
variation 485
/gene="TSPY8"
/replace="c"
/replace="t"
/db_xref="dbSNP:1556180155"
exon 533..610
/gene="TSPY8"
/inference="alignment:Splign:2.1.0"
exon 611..722
/gene="TSPY8"
/inference="alignment:Splign:2.1.0"
exon 723..868
/gene="TSPY8"
/inference="alignment:Splign:2.1.0"
variation 736
/gene="TSPY8"
/replace="a"
/replace="t"
/db_xref="dbSNP:1603140196"
variation 741..742
/gene="TSPY8"
/replace="c"
/replace="cc"
/db_xref="dbSNP:1338664843"
variation 741
/gene="TSPY8"
/replace="a"
/replace="c"
/db_xref="dbSNP:1432728779"
variation 749
/gene="TSPY8"
/replace="a"
/replace="g"
/db_xref="dbSNP:1278931930"
variation 750
/gene="TSPY8"
/replace="g"
/replace="t"
/db_xref="dbSNP:1603140212"
variation 754
/gene="TSPY8"
/replace="a"
/replace="g"
/db_xref="dbSNP:1603140219"
variation 757
/gene="TSPY8"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:760563458"
variation 760..762
/gene="TSPY8"
/replace=""
/replace="tct"
/db_xref="dbSNP:1216872203"
variation 762
/gene="TSPY8"
/replace="c"
/replace="t"
/db_xref="dbSNP:410975"
variation 763..764
/gene="TSPY8"
/replace="g"
/replace="gg"
/db_xref="dbSNP:1265273591"
variation 763
/gene="TSPY8"
/replace="a"
/replace="g"
/db_xref="dbSNP:1345948297"
variation 764
/gene="TSPY8"
/replace="c"
/replace="g"
/db_xref="dbSNP:1603140240"
variation 765
/gene="TSPY8"
/replace="a"
/replace="g"
/db_xref="dbSNP:1603140245"
variation 766
/gene="TSPY8"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:1603140251"
variation 770
/gene="TSPY8"
/replace="g"
/replace="t"
/db_xref="dbSNP:1603140259"
variation 777
/gene="TSPY8"
/replace="a"
/replace="g"
/db_xref="dbSNP:1238925689"
variation 781
/gene="TSPY8"
/replace="c"
/replace="g"
/db_xref="dbSNP:1200261658"
variation 782
/gene="TSPY8"
/replace="g"
/replace="t"
/db_xref="dbSNP:770855086"
variation 784
/gene="TSPY8"
/replace="g"
/replace="t"
/db_xref="dbSNP:1603140269"
variation 785
/gene="TSPY8"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:78649013"
variation 789
/gene="TSPY8"
/replace="a"
/replace="g"
/db_xref="dbSNP:759309586"
variation 820
/gene="TSPY8"
/replace="c"
/replace="t"
/db_xref="dbSNP:1194951855"
variation 821
/gene="TSPY8"
/replace="a"
/replace="c"
/db_xref="dbSNP:764478973"
variation 833
/gene="TSPY8"
/replace="a"
/replace="g"
/db_xref="dbSNP:1477246214"
variation 852
/gene="TSPY8"
/replace="c"
/replace="t"
/db_xref="dbSNP:1556180322"
exon 869..950
/gene="TSPY8"
/inference="alignment:Splign:2.1.0"
variation 946
/gene="TSPY8"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:1556180333"
exon 951..1161
/gene="TSPY8"
/inference="alignment:Splign:2.1.0"
variation 957
/gene="TSPY8"
/replace="c"
/replace="t"
/db_xref="dbSNP:368632690"
variation 961
/gene="TSPY8"
/replace="c"
/replace="g"
/db_xref="dbSNP:1603140324"
variation 972
/gene="TSPY8"
/replace="c"
/replace="g"
/db_xref="dbSNP:1603140329"
variation 998
/gene="TSPY8"
/replace="c"
/replace="g"
/db_xref="dbSNP:1603140331"
variation 1016
/gene="TSPY8"
/replace="c"
/replace="t"
/db_xref="dbSNP:77336777"
variation 1019
/gene="TSPY8"
/replace="a"
/replace="g"
/db_xref="dbSNP:1556180363"
variation 1052
/gene="TSPY8"
/replace=""
/replace="a"
/db_xref="dbSNP:1289143900"
variation 1064
/gene="TSPY8"
/replace="c"
/replace="t"
/db_xref="dbSNP:1603140339"
variation 1078
/gene="TSPY8"
/replace="a"
/replace="g"
/db_xref="dbSNP:2124350432"
variation 1086
/gene="TSPY8"
/replace="c"
/replace="g"
/db_xref="dbSNP:2016007137"
variation 1092
/gene="TSPY8"
/replace="a"
/replace="g"
/db_xref="dbSNP:2016007174"
variation 1094
/gene="TSPY8"
/replace="a"
/replace="g"
/db_xref="dbSNP:1603140344"
variation 1113
/gene="TSPY8"
/replace=""
/replace="a"
/db_xref="dbSNP:2124350447"
variation 1161
/gene="TSPY8"
/replace="a"
/replace="g"
/db_xref="dbSNP:1452080159"
ORIGIN
ggcccttcgcgcgcagtcccttagggggcgcctggaagcccggcgcatgcgccctgagggctcgctgacctactgggtgccagagaggctgcggcagggtttctgtggcgtgggtcgggcagcacaggccttggtgtgtgcgagtgccaaggagggcaccgccttcaggatggaggctgtacaggagggggcggccggggtggagagtgagcaggcggctttgggggaggaggcggtgctgctgttggatgacataatggcggaggtggaggtggtggcggaggaggagggcctcgtggagcggcgggaggaggcccagcgggcacagcaggctgtgcctggccctgggcccatgaccccagagtctgcactggaggagctgctggccgttcaggtggagctggagccggttaatgcccaagccaggaaggccttttctcggcagcgggaaaagatggagcggaggcgcaagccccacctagaccgcagaggcgccgtcatccagagcgtccctggcttctgggccaatgttattgcaaaccacccccagatgtcagccctgatcactgacgaagatgaagacatgctgagctacatggtcagcctggaggtggaagaagagaagcatcctgttcatctctgcaagatcatgttgttctttcggagtaacccctacttccagaataaagtgattaccaaggaatatctggtgaacatcacagaatacagggcttctcattccactccaattgagtggtatctggattatgaagtggaggcctatcgccgcagacaccacaacagcagccttaacttcttcaactggttctctgaccacaacttcgcaggatctaacaagattgctgagatcctatgtaaggacctgtggcgcaatcccctgcaatactacaagaggatgaagccacctgaagagggaacagagacgtcaggggactcccagttgttgagttgaatatgatggagcatcagattttacctaatacagcagaactcctaaaaagttacagccatatgcaggacggcagtactcagcatggtcttatgcacaggaactaaaggaaaaagagatcgagtcacaaaaattcaggaagagggggtaaatgtggattgtatggaatgaaaaataaacattctcaagga
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]