GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-03 06:35:37, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       NM_001243721            1161 bp    mRNA    linear   PRI 20-APR-2022
DEFINITION  Homo sapiens testis specific protein Y-linked 8 (TSPY8), mRNA.
ACCESSION   NM_001243721 XM_001127004
VERSION     NM_001243721.2
KEYWORDS    RefSeq; MANE Select.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1161)
  AUTHORS   Skaletsky H, Kuroda-Kawaguchi T, Minx PJ, Cordum HS, Hillier L,
            Brown LG, Repping S, Pyntikova T, Ali J, Bieri T, Chinwalla A,
            Delehaunty A, Delehaunty K, Du H, Fewell G, Fulton L, Fulton R,
            Graves T, Hou SF, Latrielle P, Leonard S, Mardis E, Maupin R,
            McPherson J, Miner T, Nash W, Nguyen C, Ozersky P, Pepin K, Rock S,
            Rohlfing T, Scott K, Schultz B, Strong C, Tin-Wollam A, Yang SP,
            Waterston RH, Wilson RK, Rozen S and Page DC.
  TITLE     The male-specific region of the human Y chromosome is a mosaic of
            discrete sequence classes
  JOURNAL   Nature 423 (6942), 825-837 (2003)
   PUBMED   12815422
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            AC006158.6.
            
            On Aug 10, 2020 this sequence version replaced NM_001243721.1.
            
            CCDS Note: This CCDS representation lacks full-length human
            transcript support and it is therefore inferred, but the
            full-length exon combination it is supported by partial human
            transcripts (AA608988.1 and DB476671.1) paralogous transcript
            U58096.1.
            
            ##Evidence-Data-START##
            RNAseq introns :: single sample supports all introns SAMEA1968968,
                              SAMEA2148093 [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            MANE Ensembl match     :: ENST00000287721.13/ ENSP00000287721.9
            RefSeq Select criteria :: based on manual assertion, expression,
                                      longest protein
            ##RefSeq-Attributes-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-532               AC006158.6         64443-64974
            533-610             AC006158.6         65582-65659
            611-722             AC006158.6         65788-65899
            723-868             AC006158.6         66001-66146
            869-950             AC006158.6         66253-66334
            951-1161            AC006158.6         67029-67239
FEATURES             Location/Qualifiers
     source          1..1161
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="Y"
                     /map="Yp11.2"
     gene            1..1161
                     /gene="TSPY8"
                     /note="testis specific protein Y-linked 8"
                     /db_xref="GeneID:728403"
                     /db_xref="HGNC:HGNC:37471"
     exon            1..532
                     /gene="TSPY8"
                     /inference="alignment:Splign:2.1.0"
     variation       23
                     /gene="TSPY8"
                     /replace=""
                     /replace="a"
                     /db_xref="dbSNP:755556626"
     variation       27
                     /gene="TSPY8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1384648018"
     variation       29
                     /gene="TSPY8"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:779537724"
     variation       30
                     /gene="TSPY8"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:773869877"
     variation       38
                     /gene="TSPY8"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:761252400"
     variation       42
                     /gene="TSPY8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:767443260"
     variation       44
                     /gene="TSPY8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1283571419"
     variation       45
                     /gene="TSPY8"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:773125040"
     CDS             47..973
                     /gene="TSPY8"
                     /codon_start=1
                     /product="testis-specific Y-encoded protein 8"
                     /protein_id="NP_001230650.1"
                     /db_xref="CCDS:CCDS59533.1"
                     /db_xref="GeneID:728403"
                     /db_xref="HGNC:HGNC:37471"
                     /translation="
MRPEGSLTYWVPERLRQGFCGVGRAAQALVCASAKEGTAFRMEAVQEGAAGVESEQAALGEEAVLLLDDIMAEVEVVAEEEGLVERREEAQRAQQAVPGPGPMTPESALEELLAVQVELEPVNAQARKAFSRQREKMERRRKPHLDRRGAVIQSVPGFWANVIANHPQMSALITDEDEDMLSYMVSLEVEEEKHPVHLCKIMLFFRSNPYFQNKVITKEYLVNITEYRASHSTPIEWYLDYEVEAYRRRHHNSSLNFFNWFSDHNFAGSNKIAEILCKDLWRNPLQYYKRMKPPEEGTETSGDSQLLS"
     misc_feature    422..910
                     /gene="TSPY8"
                     /note="Nucleosome assembly protein (NAP); Region: NAP;
                     cl08298"
                     /db_xref="CDD:447601"
     variation       47
                     /gene="TSPY8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2016003059"
     variation       50
                     /gene="TSPY8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1603140079"
     variation       54
                     /gene="TSPY8"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:760572223"
     variation       55
                     /gene="TSPY8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:766059501"
     variation       59
                     /gene="TSPY8"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:753631588"
     variation       60
                     /gene="TSPY8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:758572301"
     variation       64
                     /gene="TSPY8"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:764356240"
     variation       65
                     /gene="TSPY8"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:757408537"
     variation       67
                     /gene="TSPY8"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:781778860"
     variation       70
                     /gene="TSPY8"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1457488245"
     variation       73
                     /gene="TSPY8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:756541077"
     variation       76
                     /gene="TSPY8"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:780310523"
     variation       77
                     /gene="TSPY8"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:749613655"
     variation       84
                     /gene="TSPY8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1556180031"
     variation       85
                     /gene="TSPY8"
                     /replace=""
                     /replace="g"
                     /db_xref="dbSNP:753549902"
     variation       88
                     /gene="TSPY8"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:768306591"
     variation       91
                     /gene="TSPY8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:778466849"
     variation       94
                     /gene="TSPY8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1367283915"
     variation       98
                     /gene="TSPY8"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1476646611"
     variation       105
                     /gene="TSPY8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:747718289"
     variation       110
                     /gene="TSPY8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1172231287"
     variation       113
                     /gene="TSPY8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:771553199"
     variation       116
                     /gene="TSPY8"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:773243424"
     variation       181
                     /gene="TSPY8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:387087"
     variation       188
                     /gene="TSPY8"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1464787539"
     variation       230
                     /gene="TSPY8"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1603140150"
     variation       358
                     /gene="TSPY8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1603140154"
     variation       437
                     /gene="TSPY8"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1556180134"
     variation       460
                     /gene="TSPY8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1556180143"
     variation       478
                     /gene="TSPY8"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1328941043"
     variation       485
                     /gene="TSPY8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1556180155"
     exon            533..610
                     /gene="TSPY8"
                     /inference="alignment:Splign:2.1.0"
     exon            611..722
                     /gene="TSPY8"
                     /inference="alignment:Splign:2.1.0"
     exon            723..868
                     /gene="TSPY8"
                     /inference="alignment:Splign:2.1.0"
     variation       736
                     /gene="TSPY8"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1603140196"
     variation       741..742
                     /gene="TSPY8"
                     /replace="c"
                     /replace="cc"
                     /db_xref="dbSNP:1338664843"
     variation       741
                     /gene="TSPY8"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1432728779"
     variation       749
                     /gene="TSPY8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1278931930"
     variation       750
                     /gene="TSPY8"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1603140212"
     variation       754
                     /gene="TSPY8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1603140219"
     variation       757
                     /gene="TSPY8"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:760563458"
     variation       760..762
                     /gene="TSPY8"
                     /replace=""
                     /replace="tct"
                     /db_xref="dbSNP:1216872203"
     variation       762
                     /gene="TSPY8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:410975"
     variation       763..764
                     /gene="TSPY8"
                     /replace="g"
                     /replace="gg"
                     /db_xref="dbSNP:1265273591"
     variation       763
                     /gene="TSPY8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1345948297"
     variation       764
                     /gene="TSPY8"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1603140240"
     variation       765
                     /gene="TSPY8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1603140245"
     variation       766
                     /gene="TSPY8"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1603140251"
     variation       770
                     /gene="TSPY8"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1603140259"
     variation       777
                     /gene="TSPY8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1238925689"
     variation       781
                     /gene="TSPY8"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1200261658"
     variation       782
                     /gene="TSPY8"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:770855086"
     variation       784
                     /gene="TSPY8"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1603140269"
     variation       785
                     /gene="TSPY8"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:78649013"
     variation       789
                     /gene="TSPY8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:759309586"
     variation       820
                     /gene="TSPY8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1194951855"
     variation       821
                     /gene="TSPY8"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:764478973"
     variation       833
                     /gene="TSPY8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1477246214"
     variation       852
                     /gene="TSPY8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1556180322"
     exon            869..950
                     /gene="TSPY8"
                     /inference="alignment:Splign:2.1.0"
     variation       946
                     /gene="TSPY8"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1556180333"
     exon            951..1161
                     /gene="TSPY8"
                     /inference="alignment:Splign:2.1.0"
     variation       957
                     /gene="TSPY8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:368632690"
     variation       961
                     /gene="TSPY8"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1603140324"
     variation       972
                     /gene="TSPY8"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1603140329"
     variation       998
                     /gene="TSPY8"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1603140331"
     variation       1016
                     /gene="TSPY8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:77336777"
     variation       1019
                     /gene="TSPY8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1556180363"
     variation       1052
                     /gene="TSPY8"
                     /replace=""
                     /replace="a"
                     /db_xref="dbSNP:1289143900"
     variation       1064
                     /gene="TSPY8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1603140339"
     variation       1078
                     /gene="TSPY8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2124350432"
     variation       1086
                     /gene="TSPY8"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:2016007137"
     variation       1092
                     /gene="TSPY8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2016007174"
     variation       1094
                     /gene="TSPY8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1603140344"
     variation       1113
                     /gene="TSPY8"
                     /replace=""
                     /replace="a"
                     /db_xref="dbSNP:2124350447"
     variation       1161
                     /gene="TSPY8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1452080159"
ORIGIN      
ggcccttcgcgcgcagtcccttagggggcgcctggaagcccggcgcatgcgccctgagggctcgctgacctactgggtgccagagaggctgcggcagggtttctgtggcgtgggtcgggcagcacaggccttggtgtgtgcgagtgccaaggagggcaccgccttcaggatggaggctgtacaggagggggcggccggggtggagagtgagcaggcggctttgggggaggaggcggtgctgctgttggatgacataatggcggaggtggaggtggtggcggaggaggagggcctcgtggagcggcgggaggaggcccagcgggcacagcaggctgtgcctggccctgggcccatgaccccagagtctgcactggaggagctgctggccgttcaggtggagctggagccggttaatgcccaagccaggaaggccttttctcggcagcgggaaaagatggagcggaggcgcaagccccacctagaccgcagaggcgccgtcatccagagcgtccctggcttctgggccaatgttattgcaaaccacccccagatgtcagccctgatcactgacgaagatgaagacatgctgagctacatggtcagcctggaggtggaagaagagaagcatcctgttcatctctgcaagatcatgttgttctttcggagtaacccctacttccagaataaagtgattaccaaggaatatctggtgaacatcacagaatacagggcttctcattccactccaattgagtggtatctggattatgaagtggaggcctatcgccgcagacaccacaacagcagccttaacttcttcaactggttctctgaccacaacttcgcaggatctaacaagattgctgagatcctatgtaaggacctgtggcgcaatcccctgcaatactacaagaggatgaagccacctgaagagggaacagagacgtcaggggactcccagttgttgagttgaatatgatggagcatcagattttacctaatacagcagaactcctaaaaagttacagccatatgcaggacggcagtactcagcatggtcttatgcacaggaactaaaggaaaaagagatcgagtcacaaaaattcaggaagagggggtaaatgtggattgtatggaatgaaaaataaacattctcaagga
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]