2024-03-29 09:23:48, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_001173531 1579 bp mRNA linear PRI 25-DEC-2023 DEFINITION Homo sapiens POU class 5 homeobox 1 (POU5F1), transcript variant 3, mRNA. ACCESSION NM_001173531 VERSION NM_001173531.3 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 1579) AUTHORS Hong L, Hong S and Zhang X. TITLE Expression and Functional Analysis of core stemness factors OSKM (OCT4, SOX2, KLF4, and MYC) in Pan-cancer JOURNAL Medicine (Baltimore) 102 (48), e36433 (2023) PUBMED 38050242 REMARK GeneRIF: Expression and Functional Analysis of core stemness factors OSKM (OCT4, SOX2, KLF4, and MYC) in Pan-cancer. REFERENCE 2 (bases 1 to 1579) AUTHORS Panayiotou T, Eftychiou M, Patera E, Promponas VJ and Strati K. TITLE A paradigm for post-embryonic Oct4 re-expression: E7-induced hydroxymethylation regulates Oct4 expression in cervical cancer JOURNAL J Med Virol 95 (12), e29264 (2023) PUBMED 38054553 REMARK GeneRIF: A paradigm for post-embryonic Oct4 re-expression: E7-induced hydroxymethylation regulates Oct4 expression in cervical cancer. REFERENCE 3 (bases 1 to 1579) AUTHORS Wang X and Dai J. TITLE Concise review: isoforms of OCT4 contribute to the confusing diversity in stem cell biology JOURNAL Stem Cells 28 (5), 885-893 (2010) PUBMED 20333750 REMARK GeneRIF: This review article underscores the importance of identifying and discriminating the expression and functions of OCT4 isoforms in stem cell research. Review article REFERENCE 4 (bases 1 to 1579) AUTHORS Zhang W, Wang X, Xiao Z, Liu W, Chen B and Dai J. TITLE Mapping of the minimal internal ribosome entry site element in the human embryonic stem cell gene OCT4B mRNA JOURNAL Biochem Biophys Res Commun 394 (3), 750-754 (2010) PUBMED 20230781 REMARK GeneRIF: a 30-nt sequence (nt 201-231), which is sufficient to promote internal initiation of translation of OCT4B mRNA in embryonic stem cells was mapped. REFERENCE 5 (bases 1 to 1579) AUTHORS Wang X, Zhao Y, Xiao Z, Chen B, Wei Z, Wang B, Zhang J, Han J, Gao Y, Li L, Zhao H, Zhao W, Lin H and Dai J. TITLE Alternative translation of OCT4 by an internal ribosome entry site and its novel function in stress response JOURNAL Stem Cells 27 (6), 1265-1275 (2009) PUBMED 19489092 REMARK GeneRIF: OCT4 gene, by the regulation of alternative splicing and alternative translation initiation, may carry out more crucial roles in many biological events. GeneRIF: Shows that isoform OCT4B-190 initiates at a non-AUG (CUG) translation initiation codon. REFERENCE 6 (bases 1 to 1579) AUTHORS Atlasi Y, Mowla SJ, Ziaee SA, Gokhale PJ and Andrews PW. TITLE OCT4 spliced variants are differentially expressed in human pluripotent and nonpluripotent cells JOURNAL Stem Cells 26 (12), 3068-3074 (2008) PUBMED 18787205 REMARK GeneRIF: OCT4 spliced variants are differentially expressed in human pluripotent and nonpluripotent cells REFERENCE 7 (bases 1 to 1579) AUTHORS Lee J, Kim HK, Rho JY, Han YM and Kim J. TITLE The human OCT-4 isoforms differ in their ability to confer self-renewal JOURNAL J Biol Chem 281 (44), 33554-33565 (2006) PUBMED 16951404 REMARK GeneRIF: DNA binding, transactivation, and abilities to confer self-renewal of the human OCT-4 isoforms differ REFERENCE 8 (bases 1 to 1579) AUTHORS Wey E, Lyons GE and Schafer BW. TITLE A human POU domain gene, mPOU, is expressed in developing brain and specific adult tissues JOURNAL Eur J Biochem 220 (3), 753-762 (1994) PUBMED 7908264 REFERENCE 9 (bases 1 to 1579) AUTHORS Takeda J, Seino S and Bell GI. TITLE Human Oct3 gene family: cDNA sequences, alternative splicing, gene organization, chromosomal location, and expression at low levels in adult tissues JOURNAL Nucleic Acids Res 20 (17), 4613-4620 (1992) PUBMED 1408763 REFERENCE 10 (bases 1 to 1579) AUTHORS Schoorlemmer J and Kruijer W. TITLE Octamer-dependent regulation of the kFGF gene in embryonal carcinoma and embryonic stem cells JOURNAL Mech Dev 36 (1-2), 75-86 (1991) PUBMED 1723621 COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from DQ486514.1, DQ486516.1, DQ486515.1 and AI811039.1. On Aug 13, 2020 this sequence version replaced NM_001173531.2. Summary: This gene encodes a transcription factor containing a POU homeodomain that plays a key role in embryonic development and stem cell pluripotency. Aberrant expression of this gene in adult tissues is associated with tumorigenesis. This gene can participate in a translocation with the Ewing's sarcoma gene on chromosome 21, which also leads to tumor formation. Alternative splicing, as well as usage of alternative AUG and non-AUG translation initiation codons, results in multiple isoforms. One of the AUG start codons is polymorphic in human populations. Related pseudogenes have been identified on chromosomes 1, 3, 8, 10, and 12. [provided by RefSeq, Oct 2013]. Transcript Variant: This variant (3) differs in the 5' UTR, lacks a portion of the 5' coding region, and initiates translation at a downstream in-frame non-AUG (CUG) start codon, compared to variant 1. The resulting isoform (2, also known as OCT4B-190) is shorter at the N-terminus, compared to isoform 1. Variants 2 and 3 encode the same isoform (2). This variant may encode an additional isoform through the use of an alternative downstream AUG start codon. Use of alternate start codons and the non-AUG start codon is described in PMID:19489092. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: KF880691.1, DQ486516.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMEA2150385, SAMEA2157511 [ECO:0000348] ##Evidence-Data-END## ##RefSeq-Attributes-START## non-AUG initiation codon :: PMID: 19489092 ##RefSeq-Attributes-END## COMPLETENESS: complete on the 3' end. PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-332 DQ486514.1 1-332 333-563 DQ486516.1 1-231 564-564 DQ486515.1 232-232 565-1565 DQ486516.1 233-1233 1566-1579 AI811039.1 11-24 c FEATURES Location/Qualifiers source 1..1579 /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="6" /map="6p21.33" gene 1..1579 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /note="POU class 5 homeobox 1" /db_xref="GeneID:5460" /db_xref="HGNC:HGNC:9221" /db_xref="MIM:164177" exon 1..637 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /inference="alignment:Splign:2.1.0" variation 1 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:756575303" variation 3..8 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="aaaaa" /replace="aaaaaa" /db_xref="dbSNP:1777333579" variation 3 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1777333859" variation 5 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:2151108087" variation 15 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:556183524" variation 19 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1777333028" variation 20..21 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="t" /replace="tt" /db_xref="dbSNP:1777332518" variation 20 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1230878174" variation 22 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:1343020362" variation 25 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:945378480" variation 33 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:915242328" variation 35 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /replace="g" /db_xref="dbSNP:1473749165" variation 38 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:767061672" variation 39 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /db_xref="dbSNP:1244144141" variation 41 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /db_xref="dbSNP:1777330580" variation 42 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:932840583" variation 48 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1777330048" variation 55 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1777329779" variation 56 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:1323733874" variation 59..88 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="caaatagcacttctgtcatgctggatgtca" /replace="caaatagcacttctgtcatgctggatgtcaaatagcacttctgtcatg ctggatgtca" /db_xref="dbSNP:1777326521" variation 59 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1777329221" variation 60 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /replace="t" /db_xref="dbSNP:3130931" variation 61 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:2151107929" variation 67 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /db_xref="dbSNP:1223033686" variation 68 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1054562013" variation 70 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:1371054306" variation 73 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1777328204" variation 73 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="ggatgaagaacaag" /db_xref="dbSNP:1309830792" variation 74..75 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="" /replace="atgaagaacaagtgccga" /replace="gccga" /db_xref="dbSNP:1409890798" variation 74 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:1777327959" variation 76 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /replace="g" /db_xref="dbSNP:935889637" variation 77 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1308827226" variation 79 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1777326787" variation 90 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /db_xref="dbSNP:1777326233" variation 91 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:750002991" variation 94 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /db_xref="dbSNP:1777325711" variation 95 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1777325278" variation 101 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:979949563" variation 102 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1364491233" variation 103 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1777324518" variation 106 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="t" /db_xref="dbSNP:573550776" variation 107 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:2151107769" variation 114 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1300756432" variation 115 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:76465289" variation 120 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1777323508" variation 125 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1356944417" variation 126 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:1777322994" variation 127 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1777322739" variation 130 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1777322487" variation 132 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:1229902923" variation 135 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /replace="t" /db_xref="dbSNP:536581051" variation 136 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /replace="g" /db_xref="dbSNP:983180480" variation 137 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1454069209" variation 139..141 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="aa" /replace="aaa" /db_xref="dbSNP:1777320959" variation 142 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1484264122" variation 144 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1777320435" variation 147 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1777320187" variation 151 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:769146675" variation 154 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:977786363" variation 156 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1371506489" variation 162 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:566021008" variation 163 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1777318676" variation 167 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:1582037748" variation 171 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1410508850" variation 172 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1777317928" variation 176 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1173026294" variation 179 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:749630858" variation 189 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:1777317122" variation 190 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="aa" /db_xref="dbSNP:2151107559" variation 191 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /db_xref="dbSNP:1166012936" variation 192 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /replace="g" /db_xref="dbSNP:950476755" variation 193 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1777316548" variation 199 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:2151107531" variation 201 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1184040360" variation 203 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1777316008" variation 206 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:776087600" variation 221 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /replace="g" /db_xref="dbSNP:200340326" variation 222..225 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="atga" /replace="atgatga" /db_xref="dbSNP:67207605" variation 222 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1185683743" variation 223..224 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="" /replace="aag" /replace="tag" /db_xref="dbSNP:1777314586" variation 223 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:77085553" variation 224..226 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="gag" /replace="gaggag" /db_xref="dbSNP:9281235" variation 224..225 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="ga" /replace="gaaga" /replace="gacga" /db_xref="dbSNP:1777313779" variation 224 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="ggag" /replace="gtgg" /db_xref="dbSNP:72545985" variation 225..228 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="agta" /replace="agtagta" /db_xref="dbSNP:2151107394" variation 225..226 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="ag" /replace="agaag" /db_xref="dbSNP:141270342" variation 226..227 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="" /replace="gat" /db_xref="dbSNP:1777312621" variation 226 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="gagg" /db_xref="dbSNP:1554135573" variation 227 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="" /replace="t" /db_xref="dbSNP:1372634738" variation 227 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:201576321" variation 227 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="t" /replace="tt" /db_xref="dbSNP:1777312105" variation 228..229 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="" /replace="gt" /db_xref="dbSNP:1561858807" variation 228 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1432689419" variation 229 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /db_xref="dbSNP:553951373" variation 231 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:1340775926" variation 233 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1777310661" variation 234 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1483419984" variation 237 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /db_xref="dbSNP:1777310112" variation 240 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /replace="g" /db_xref="dbSNP:1450163111" variation 248 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1268187140" variation 249 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:1208146203" variation 250 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:917183324" variation 256 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1777308694" variation 258 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /replace="t" /db_xref="dbSNP:1777308361" variation 260 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:991404678" variation 264 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /replace="g" /replace="t" /db_xref="dbSNP:1238039827" variation 271 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /replace="t" /db_xref="dbSNP:958551486" variation 274 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /replace="t" /db_xref="dbSNP:1314969939" variation 278 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:1443317976" variation 279 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /db_xref="dbSNP:1290134588" variation 280..284 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="tgt" /replace="tgtgt" /db_xref="dbSNP:571828146" variation 280 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1240827545" variation 281 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /db_xref="dbSNP:920402080" variation 283 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:2151107235" variation 286 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="t" /db_xref="dbSNP:2151107222" variation 287 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:995080389" variation 289 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1777304963" variation 294 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:961733064" variation 295 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1014676128" variation 297 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /db_xref="dbSNP:2151107175" variation 299 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1777304114" variation 300..301 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="cc" /replace="ccc" /db_xref="dbSNP:1777303834" variation 302 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /db_xref="dbSNP:2151107154" variation 308 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /replace="t" /db_xref="dbSNP:1172171053" variation 313 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1777303249" variation 314 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:1402669669" variation 319 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /db_xref="dbSNP:1777302766" variation 320 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /db_xref="dbSNP:1280756512" variation 321 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1388044631" variation 323 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:72856737" variation 328 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:868073649" variation 329 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /db_xref="dbSNP:2151107091" variation 331 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /db_xref="dbSNP:571668450" variation 333 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /replace="t" /db_xref="dbSNP:759635638" variation 338 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:2151107071" variation 340 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /db_xref="dbSNP:1368067216" variation 346 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1232121017" variation 348 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="t" /db_xref="dbSNP:545437201" variation 349 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:9263800" variation 355 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:1777299299" variation 356 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1777299064" variation 357 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:11965454" variation 358 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1777298772" variation 364 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:2151107008" variation 365 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:2151106995" variation 366 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1282835556" variation 367..369 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="aca" /db_xref="dbSNP:1429225310" variation 367 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="t" /db_xref="dbSNP:1464849350" variation 369 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1473170859" variation 370 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1777297246" variation 371 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:893827576" variation 374 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1250012422" variation 375 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1467154259" variation 376 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1777296078" variation 377 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1777295791" variation 380..381 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="cc" /db_xref="dbSNP:1198482935" variation 380 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /db_xref="dbSNP:1777295522" variation 382..386 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="tttt" /replace="ttttt" /db_xref="dbSNP:1378392227" variation 384 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:1777294937" variation 387 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1777294345" variation 388 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1777294068" variation 394 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1478925844" variation 396 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1777293504" variation 397 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /db_xref="dbSNP:1156581301" variation 400 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1410882052" variation 404 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /db_xref="dbSNP:2151106839" variation 407 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /db_xref="dbSNP:567697919" variation 409 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /replace="t" /db_xref="dbSNP:1322418862" variation 416 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:3757349" variation 434 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:903306193" variation 440 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /db_xref="dbSNP:1777291168" variation 443 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /db_xref="dbSNP:1777290863" variation 448 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:2151106776" variation 450 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /replace="t" /db_xref="dbSNP:775390135" variation 451 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1323876773" variation 453 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="t" /db_xref="dbSNP:1777289999" variation 455 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /replace="t" /db_xref="dbSNP:905789598" variation 458..460 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="gag" /db_xref="dbSNP:1777289394" variation 460..462 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="gtg" /replace="gtgtg" /db_xref="dbSNP:1777289142" variation 466 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:73401031" variation 468 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1777288544" variation 477 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:2151106706" variation 483 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="t" /db_xref="dbSNP:2151106697" variation 488 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:2151106686" variation 489 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /db_xref="dbSNP:1777288254" variation 494..499 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="tt" /replace="ttcttt" /db_xref="dbSNP:550996676" variation 495..497 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="t" /replace="tct" /db_xref="dbSNP:1554135441" variation 496 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="" /replace="c" /db_xref="dbSNP:1554135451" variation 496 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /replace="t" /db_xref="dbSNP:1777287697" variation 497..508 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="ttttttttt" /replace="tttttttttt" /replace="ttttttttttt" /replace="tttttttttttt" /replace="ttttttttttttt" /db_xref="dbSNP:rs9279005" variation 497 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1204843522" variation 502 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:949924521" variation 504 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1463720016" variation 507 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1269728421" variation 508 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:201876558" variation 509 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="" /replace="c" /db_xref="dbSNP:1777284056" variation 509 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:200941459" variation 513 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="" /replace="g" /db_xref="dbSNP:1322683938" variation 513 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:1209148552" variation 518..521 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="ag" /replace="agag" /db_xref="dbSNP:776463063" variation 518 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="aa" /db_xref="dbSNP:1777282729" variation 521 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1254214943" variation 526 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1250844879" variation 527..530 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="ct" /replace="ctct" /db_xref="dbSNP:1234752211" variation 529 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1777281473" variation 531 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1161350339" variation 534 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /replace="t" /db_xref="dbSNP:1777280491" variation 535 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1777280177" variation 538 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /db_xref="dbSNP:950118066" variation 540 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /replace="t" /db_xref="dbSNP:1457019029" variation 546 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:574609806" variation 547 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /replace="t" /db_xref="dbSNP:1582036271" variation 555 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1380101000" variation 556 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:983642581" variation 570 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /db_xref="dbSNP:1306970706" variation 575 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /db_xref="dbSNP:1582036200" variation 576 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1777277431" variation 580 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1322911050" variation 581 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:929059992" variation 585 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1777276499" variation 586 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /db_xref="dbSNP:1777276066" variation 587 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /replace="t" /db_xref="dbSNP:141017974" variation 588 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1300309753" variation 592 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:1777274980" variation 595 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="t" /db_xref="dbSNP:1777274684" variation 599 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /db_xref="dbSNP:1561857968" variation 604 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1582036092" variation 605 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1777273790" variation 608 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:973063617" variation 609 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /db_xref="dbSNP:1582036067" variation 610 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:964318755" variation 611 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1777272508" misc_feature 623..625 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /note="upstream in-frame stop codon" variation 625 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:151095308" variation 626 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /db_xref="dbSNP:1777271795" variation 628 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1582036011" variation 635 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1777271173" exon 638..758 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /inference="alignment:Splign:2.1.0" variation 639 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /db_xref="dbSNP:768359010" variation 642 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1489249310" variation 643 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /db_xref="dbSNP:1387884870" variation 646 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1167606498" variation 649 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /replace="t" /db_xref="dbSNP:749071230" variation 650 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1408966195" variation 651 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1288972831" variation 653 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /db_xref="dbSNP:1244494688" variation 654 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:149025884" variation 656 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1226467340" variation 657 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:137936040" variation 662 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1777208385" variation 670 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /replace="t" /db_xref="dbSNP:751745427" variation 671 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /replace="g" /db_xref="dbSNP:777993058" variation 673 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1321757885" variation 676 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:150320288" variation 679 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:1274145021" variation 680 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:2151104326" variation 688 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1561856346" variation 694 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1777205659" variation 699 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /db_xref="dbSNP:1777205330" variation 706 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1247046824" variation 709 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1361655165" variation 710 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1272018324" variation 718 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1777203896" variation 724 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1313084641" variation 727 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1395953191" variation 728 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1374605227" variation 736 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:752871883" variation 739 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1440419653" variation 741 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /replace="t" /db_xref="dbSNP:910240285" CDS 743..1315 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /note="isoform 2 is encoded by transcript variant 3; non-AUG (CUG) translation initiation codon; POU-type homeodomain-containing DNA-binding protein; POU domain transcription factor OCT4; POU domain, class 5, transcription factor 1; octamer-binding protein 3; octamer-binding protein 4; octamer-binding transcription factor 3" /codon_start=1 /product="POU domain, class 5, transcription factor 1 isoform 2" /protein_id="NP_001167002.1" /db_xref="CCDS:CCDS47398.2" /db_xref="GeneID:5460" /db_xref="HGNC:HGNC:9221" /db_xref="MIM:164177" /translation="
MGVLFGKVFSQTTICRFEALQLSFKNMCKLRPLLQKWVEEADNNENLQEICKAETLVQARKRKRTSIENRVRGNLENLFLQCPKPTLQQISHIAQQLGLEKDVVRVWFCNRRQKGKRSSSDYAQREDFEAAGSPFSGGPVSFPLAPGPHFGTPGYGSPHFTALYSSVPFPEGEAFPPVSVTTLGSPMHSN"
misc_feature <743..868 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /note="Pou domain - N-terminal to homeobox domain; Region: Pou; cl22952" /db_xref="CDD:451464" misc_feature 821..823 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /note="OCT4B-164; Region: Alternative start codon" misc_feature order(923..937,941..943,992..994,1010..1012,1049..1051, 1055..1060,1067..1072,1076..1084,1088..1093) /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 929..1090 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:425441" misc_feature order(929..931,938..940,1058..1060,1067..1072,1079..1081) /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" variation 750 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /replace="t" /db_xref="dbSNP:1307000564" variation 754 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1582032778" variation 755 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="t" /db_xref="dbSNP:1777200309" exon 759..889 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /inference="alignment:Splign:2.1.0" variation 760 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:754269967" variation 764 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1329745808" variation 766 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:951425605" variation 771 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1298706028" variation 778 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /replace="g" /db_xref="dbSNP:373808092" variation 781 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /db_xref="dbSNP:1777172331" variation 784 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1362025857" variation 787 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1290187689" variation 789 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1777171228" variation 805 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /db_xref="dbSNP:1455194086" variation 809 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1777170549" variation 814 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1387743881" variation 816 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:756413624" variation 829 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1777169354" variation 832 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:115234511" variation 833 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:768029325" variation 834 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1037478772" variation 838 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1429404142" variation 846 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /db_xref="dbSNP:2151103219" variation 859 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /replace="g" /db_xref="dbSNP:1341968669" variation 864 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1777167062" variation 869 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /db_xref="dbSNP:1007322893" variation 874 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="t" /db_xref="dbSNP:1777166338" variation 878 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="t" /db_xref="dbSNP:572480837" variation 879 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /db_xref="dbSNP:1777165573" variation 885 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /db_xref="dbSNP:1186685294" variation 887 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:773889469" variation 889 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:763710527" exon 890..1048 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /inference="alignment:Splign:2.1.0" variation 891 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1777140852" variation 892 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="t" /db_xref="dbSNP:1777140477" variation 893 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /replace="t" /db_xref="dbSNP:1441261772" variation 894 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1256075529" variation 897 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /db_xref="dbSNP:1196692240" variation 901 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1016182724" variation 908 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /replace="t" /db_xref="dbSNP:1150767" variation 910 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /replace="t" /db_xref="dbSNP:780201728" variation 911 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /replace="g" /db_xref="dbSNP:750755680" variation 916 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:767958442" variation 917 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1340827343" variation 920 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1315221039" variation 921 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1246353090" variation 924 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1777135286" variation 925 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1338565059" variation 930 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1333452170" variation 932 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1777134129" variation 937 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /db_xref="dbSNP:1391716274" variation 938 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1777133457" variation 940 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:2151102295" variation 943 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:757769384" variation 948 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1306384765" variation 950 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1429420206" variation 951 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:751096375" variation 952 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="t" /db_xref="dbSNP:368434272" variation 954 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="t" /db_xref="dbSNP:1471859282" variation 955 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:1368353231" variation 957 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1777130443" variation 958 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1183206781" variation 959 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /replace="g" /db_xref="dbSNP:1052108705" variation 961 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:578180451" variation 976 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:775301501" variation 980 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /replace="t" /db_xref="dbSNP:1325738578" variation 991 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:764939136" variation 997 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /replace="g" /db_xref="dbSNP:17851818" variation 1000 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:951452940" variation 1001 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1777126425" variation 1003 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:776478147" variation 1011 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1353681075" variation 1014 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:770844532" variation 1019 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1777125291" variation 1021 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:746974556" variation 1030 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1352084514" variation 1034 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1286303728" variation 1035 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1408995142" variation 1036 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1427351164" variation 1039 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /replace="t" /db_xref="dbSNP:772966815" variation 1040 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:768746587" variation 1043 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:749326531" variation 1044 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1777122104" variation 1046 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /replace="g" /db_xref="dbSNP:1390168415" exon 1049..1579 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /inference="alignment:Splign:2.1.0" variation 1049 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1188579160" variation 1050 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:770067555" variation 1051 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1246075526" variation 1054 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /replace="t" /db_xref="dbSNP:1777088374" variation 1055 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1208076129" variation 1056 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:746104715" variation 1057 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1384083039" variation 1059 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:1280550252" variation 1060 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1298955101" variation 1062 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /replace="g" /db_xref="dbSNP:867664390" variation 1066 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:781212227" variation 1074 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1271010739" variation 1075 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1437313632" variation 1076 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /db_xref="dbSNP:1777084166" variation 1078 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1777083772" variation 1085 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1777083413" variation 1086 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1363163301" variation 1091 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1777082620" variation 1100 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:771345851" variation 1102 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:141766253" variation 1103 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:778460021" variation 1107 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1777081085" variation 1108 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1174320263" variation 1110 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:546320542" variation 1111..1115 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="ac" /replace="acaac" /db_xref="dbSNP:765569430" variation 1113 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1777079901" variation 1114 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1423969939" variation 1116 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:950764201" variation 1118 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /db_xref="dbSNP:1486650077" variation 1127 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:758948344" variation 1138 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1777077666" variation 1140 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:752325450" variation 1142 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /db_xref="dbSNP:1189046873" variation 1151 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:778574549" variation 1153 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /db_xref="dbSNP:1314271734" variation 1155 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1030266660" variation 1160 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /replace="g" /db_xref="dbSNP:1483497814" variation 1164 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /replace="t" /db_xref="dbSNP:974056564" variation 1165 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1480295008" variation 1168 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1777074060" variation 1172 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1200837847" variation 1173 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:16897482" variation 1175 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1777072975" variation 1176 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1207698528" variation 1177 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /db_xref="dbSNP:1432082123" variation 1178 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1441659931" variation 1183 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:754481951" variation 1187 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1230947193" variation 1192 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:1777070734" variation 1198 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /replace="t" /db_xref="dbSNP:753553081" variation 1205 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:765910375" variation 1211 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1777069475" variation 1213 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /db_xref="dbSNP:1246815764" variation 1216 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="t" /db_xref="dbSNP:1158543431" variation 1219 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1374581600" variation 1225 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:997814201" variation 1228 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1301635040" variation 1231 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1777067093" variation 1233 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /db_xref="dbSNP:760558360" variation 1236 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /db_xref="dbSNP:1355522268" variation 1239 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:750163518" variation 1240 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:767500519" variation 1241 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1387940273" variation 1244 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1016136973" variation 1251 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1038848905" variation 1252 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:761734933" variation 1256 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /replace="t" /db_xref="dbSNP:986006262" variation 1258 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1777063161" variation 1262 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1348560317" variation 1264 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:953270489" variation 1265 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1284370986" variation 1266 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="t" /db_xref="dbSNP:1318153696" variation 1270 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /db_xref="dbSNP:774206292" variation 1271..1273 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="" /replace="cct" /db_xref="dbSNP:1777060496" variation 1271 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:769875118" variation 1274 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1777060142" variation 1279 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1061118" variation 1280 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1207558407" variation 1284 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1061120" variation 1287 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /db_xref="dbSNP:776940833" variation 1290 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1274211726" variation 1292 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1222340156" variation 1293 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /db_xref="dbSNP:1777056973" variation 1294 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:771024256" variation 1296 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /db_xref="dbSNP:1223697753" variation 1302 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="t" /db_xref="dbSNP:747446765" variation 1310 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1191115401" variation 1316 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1427929496" variation 1317 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:997296748" variation 1320 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /replace="t" /db_xref="dbSNP:892230384" variation 1325 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1554134152" variation 1326 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:564148752" variation 1332 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1434585421" variation 1334..1335 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="aa" /replace="aaa" /db_xref="dbSNP:1408399482" variation 1335 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1777052599" variation 1337..1341 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="gggg" /replace="ggggg" /db_xref="dbSNP:1351162048" variation 1337 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:1368265136" variation 1339 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1307060444" variation 1341 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /replace="g" /db_xref="dbSNP:1457938687" variation 1343 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /replace="t" /db_xref="dbSNP:1162581262" variation 1344..1345 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="" /replace="ag" /db_xref="dbSNP:1491028222" variation 1344 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="" /replace="a" /db_xref="dbSNP:1163021077" variation 1344 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="aa" /db_xref="dbSNP:1554134128" variation 1344 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:772503540" variation 1346 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /replace="g" /db_xref="dbSNP:748680648" variation 1352 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1777048797" variation 1354 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:1777048444" variation 1355 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:903483977" variation 1356 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:779517517" variation 1359 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:754549702" variation 1363 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /replace="g" /db_xref="dbSNP:1251306973" variation 1369 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1777046704" variation 1371 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1061126" variation 1376 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1777045960" variation 1381..1383 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="tt" /replace="ttt" /db_xref="dbSNP:1777045583" variation 1384 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1777045236" variation 1386 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /replace="g" /db_xref="dbSNP:1777044891" variation 1387 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1304742773" variation 1388 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:2151100101" variation 1390 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:3734864" variation 1391 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /db_xref="dbSNP:1409164251" variation 1392 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1189358100" variation 1393 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /replace="t" /db_xref="dbSNP:1777042927" variation 1418 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1472556225" variation 1420 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1249631450" variation 1430 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /replace="t" /db_xref="dbSNP:1226100360" variation 1434 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:1777041453" variation 1440..1442 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="aaa" /replace="aaaaa" /db_xref="dbSNP:60004964" variation 1440 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /db_xref="dbSNP:1777041138" variation 1441 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /replace="g" /db_xref="dbSNP:200275741" variation 1445 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:917547918" variation 1449 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:896681857" variation 1460..1462 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="tt" /replace="ttt" /db_xref="dbSNP:746543478" variation 1463..1466 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="gggg" /replace="ggggg" /db_xref="dbSNP:1777038521" variation 1464 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:938900222" variation 1466 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1482261391" variation 1467 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1057051690" variation 1469 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1777037472" variation 1474 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:1233955454" variation 1485 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:1777036766" variation 1496 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1777036406" variation 1507 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:930130200" variation 1517 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:537327593" variation 1518 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /db_xref="dbSNP:1481698220" variation 1519 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1265122857" variation 1520 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1777034633" variation 1523 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /replace="g" /db_xref="dbSNP:927467930" variation 1526 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="t" /db_xref="dbSNP:980276667" variation 1527 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:2151099846" variation 1531 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="" /replace="c" /db_xref="dbSNP:1777033427" variation 1532 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:1388129250" variation 1534 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="g" /replace="t" /db_xref="dbSNP:1777032759" variation 1540..1547 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="taaa" /replace="taaataaa" /db_xref="dbSNP:1409128704" variation 1541..1543 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="aa" /replace="aaa" /db_xref="dbSNP:1777032031" variation 1541 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1323343063" regulatory 1542..1547 /regulatory_class="polyA_signal_sequence" /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /note="hexamer: AATAAA" variation 1545..1550 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="aa" /replace="aaagaa" /db_xref="dbSNP:1777031252" variation 1551..1553 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="" /replace="gcc" /db_xref="dbSNP:750617181" variation 1552 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /replace="g" /db_xref="dbSNP:1313339858" variation 1553 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:13409" variation 1562 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /db_xref="dbSNP:1356217144" variation 1564 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="t" /db_xref="dbSNP:1777029217" variation 1568 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="t" /db_xref="dbSNP:1777028855" variation 1569..1571 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="aga" /db_xref="dbSNP:1777028490" variation 1572 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="c" /replace="t" /db_xref="dbSNP:983923886" variation 1575 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="a" /replace="g" /db_xref="dbSNP:1445660115" variation 1578 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /replace="c" /replace="g" /replace="t" /db_xref="dbSNP:974089105" polyA_site 1579 /gene="POU5F1" /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3; OTF3; OTF4" /note="major polyA site" ORIGIN
ggaaaaaaggaaagtgcacttggaagagatccaagtgggcaacttgaagaacaagtgccaaatagcacttctgtcatgctggatgtcagggctctttgtccactttgtatagccgctggcttatagaaggtgctcgataaatctcttgaatttaaaaatcaattaggatgcctctatagtgaaaaagatacagtaaagatgagggataatcaatttaaaaaatgagtaagtacacacaaagcactttatccattcttatgacacctgttacttttttgctgtgtttgtgtgtatgcatgccatgttatagtttgtgggaccctcaaagcaagctggggagagtatatactgaatttagcttctgagacatgatgctcttcctttttaattaacccagaacttagcagcttatctatttctctaatctcaaaacatccttaaactgggggtgatacttgagtgagagaattttgcaggtattaaatgaactatcttcttttttttttttctttgagacagagtcttgctctgtcacccaggctggagtgcagtggcgtgatctcagctcactgcaacctccgcctcccgggttcaagtgattctcctgcctcagcctcctgagtagctgggattacagtcccaggacatcaaagctctgcagaaagaactcgagcaatttgccaagctcctgaagcagaagaggatcaccctgggatatacacaggccgatgtggggctcaccctgggggttctatttgggaaggtattcagccaaacgaccatctgccgctttgaggctctgcagcttagcttcaagaacatgtgtaagctgcggcccttgctgcagaagtgggtggaggaagctgacaacaatgaaaatcttcaggagatatgcaaagcagaaaccctcgtgcaggcccgaaagagaaagcgaaccagtatcgagaaccgagtgagaggcaacctggagaatttgttcctgcagtgcccgaaacccacactgcagcagatcagccacatcgcccagcagcttgggctcgagaaggatgtggtccgagtgtggttctgtaaccggcgccagaagggcaagcgatcaagcagcgactatgcacaacgagaggattttgaggctgctgggtctcctttctcagggggaccagtgtcctttcctctggccccagggccccattttggtaccccaggctatgggagccctcacttcactgcactgtactcctcggtccctttccctgagggggaagcctttccccctgtctccgtcaccactctgggctctcccatgcattcaaactgaggtgcctgcccttctaggaatgggggacagggggaggggaggagctagggaaagaaaacctggagtttgtgccagggtttttgggattaagttcttcattcactaaggaaggaattgggaacacaaagggtgggggcaggggagtttggggcaactggttggagggaaggtgaagttcaatgatgctcttgattttaatcccacatcatgtatcacttttttcttaaataaagaagcctgggacacagtagatagacacactta
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]