ver.2
Home
|
Help
|
Advanced search
Previous release (v1)
2024-04-24 03:29:58, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_001042425 3251 bp mRNA linear PRI 21-NOV-2023
DEFINITION Homo sapiens transcription factor AP-2 alpha (TFAP2A), transcript
variant 3, mRNA.
ACCESSION NM_001042425
VERSION NM_001042425.3
KEYWORDS RefSeq.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 3251)
AUTHORS Zhao J and Lan G.
TITLE TFAP2A activates HMGA1 to promote glycolysis and lung
adenocarcinoma progression
JOURNAL Pathol Res Pract 249, 154759 (2023)
PUBMED 37586214
REMARK GeneRIF: TFAP2A activates HMGA1 to promote glycolysis and lung
adenocarcinoma progression.
REFERENCE 2 (bases 1 to 3251)
AUTHORS Liu K, Xiao Y, Gan L, Li W, Zhang J and Min J.
TITLE Structural basis for specific DNA sequence motif recognition by the
TFAP2 transcription factors
JOURNAL Nucleic Acids Res 51 (15), 8270-8282 (2023)
PUBMED 37409559
REMARK GeneRIF: Structural basis for specific DNA sequence motif
recognition by the TFAP2 transcription factors.
REFERENCE 3 (bases 1 to 3251)
AUTHORS Long S, Huang G, Ouyang M, Xiao K, Zhou H, Hou A, Li Z, Zhong Z,
Zhong D, Wang Q, Xiang S and Ding X.
TITLE Epigenetically modified AP-2alpha by DNA methyltransferase
facilitates glioma immune evasion by upregulating PD-L1 expression
JOURNAL Cell Death Dis 14 (6), 365 (2023)
PUBMED 37330579
REMARK GeneRIF: Epigenetically modified AP-2alpha by DNA methyltransferase
facilitates glioma immune evasion by upregulating PD-L1 expression.
Publication Status: Online-Only
REFERENCE 4 (bases 1 to 3251)
AUTHORS Yang J, Gao Y, Yao S, Wan S and Cai H.
TITLE TFAP2A promotes cervical cancer via a positive feedback pathway
with PD-L1
JOURNAL Oncol Rep 49 (6) (2023)
PUBMED 37083077
REMARK GeneRIF: TFAP2A promotes cervical cancer via a positive feedback
pathway with PD-L1.
REFERENCE 5 (bases 1 to 3251)
AUTHORS Lin,A.E., Haldeman-Englert,C.R. and Milunsky,J.M.
TITLE Branchiooculofacial Syndrome
JOURNAL (in) Adam MP, Feldman J, Mirzaa GM, Pagon RA, Wallace SE, Bean LJH,
Gripp KW and Amemiya A (Eds.);
GENEREVIEWS(R);
(1993)
PUBMED 21634087
REFERENCE 6 (bases 1 to 3251)
AUTHORS Bardakjian,T., Weiss,A. and Schneider,A.
TITLE Microphthalmia/Anophthalmia/Coloboma Spectrum - RETIRED CHAPTER,
FOR HISTORICAL REFERENCE ONLY
JOURNAL (in) Adam MP, Feldman J, Mirzaa GM, Pagon RA, Wallace SE, Bean LJH,
Gripp KW and Amemiya A (Eds.);
GENEREVIEWS(R);
(1993)
PUBMED 20301552
REFERENCE 7 (bases 1 to 3251)
AUTHORS Murphy JE and Keen JH.
TITLE Recognition sites for clathrin-associated proteins AP-2 and AP-3 on
clathrin triskelia
JOURNAL J Biol Chem 267 (15), 10850-10855 (1992)
PUBMED 1587861
REFERENCE 8 (bases 1 to 3251)
AUTHORS Gaynor RB, Muchardt C, Xia YR, Klisak I, Mohandas T, Sparkes RS and
Lusis AJ.
TITLE Localization of the gene for the DNA-binding protein AP-2 to human
chromosome 6p22.3-pter
JOURNAL Genomics 10 (4), 1100-1102 (1991)
PUBMED 1916817
REFERENCE 9 (bases 1 to 3251)
AUTHORS Williams T and Tjian R.
TITLE Characterization of a dimerization motif in AP-2 and its function
in heterologous DNA-binding proteins
JOURNAL Science 251 (4997), 1067-1071 (1991)
PUBMED 1998122
REFERENCE 10 (bases 1 to 3251)
AUTHORS Williams T, Admon A, Luscher B and Tjian R.
TITLE Cloning and expression of AP-2, a cell-type-specific transcription
factor that activates inducible enhancer elements
JOURNAL Genes Dev 2 (12A), 1557-1569 (1988)
PUBMED 3063603
COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The
reference sequence was derived from AL138885.21, CB990517.1 and
X52611.1.
On Aug 14, 2020 this sequence version replaced NM_001042425.2.
Summary: The protein encoded by this gene is a transcription factor
that binds the consensus sequence 5'-GCCNNNGGC-3'. The encoded
protein functions as either a homodimer or as a heterodimer with
similar family members. This protein activates the transcription of
some genes while inhibiting the transcription of others. Defects in
this gene are a cause of branchiooculofacial syndrome (BOFS). Three
transcript variants encoding different isoforms have been found for
this gene.[provided by RefSeq, Dec 2009].
Transcript Variant: This variant (3) differs in the 5' UTR and
coding sequence compared to variant 1. The resulting isoform (c)
has a shorter and distinct N-terminus compared to isoform a.
Publication Note: This RefSeq record includes a subset of the
publications that are available for this gene. Please see the Gene
record to access additional publications.
##Evidence-Data-START##
Transcript exon combination :: SRR14038192.3780275.1,
SRR14038195.1348623.1 [ECO:0000332]
RNAseq introns :: single sample supports all introns
SAMEA2147596, SAMN02400289
[ECO:0000348]
##Evidence-Data-END##
COMPLETENESS: complete on the 3' end.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-95 AL138885.21 110582-110676 c
96-242 CB990517.1 28-174
243-1762 X52611.1 108-1627
1763-3245 AL138885.21 87700-89182 c
3246-3251 AL138885.21 87694-87699 c
FEATURES Location/Qualifiers
source 1..3251
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="6"
/map="6p24.3"
gene 1..3251
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/note="transcription factor AP-2 alpha"
/db_xref="GeneID:7020"
/db_xref="HGNC:HGNC:11742"
/db_xref="MIM:107580"
exon 1..242
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/inference="alignment:Splign:2.1.0"
variation 2..3
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace=""
/replace="a"
/db_xref="dbSNP:1758362510"
variation 2
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="t"
/db_xref="dbSNP:1251159018"
variation 3
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="g"
/replace="t"
/db_xref="dbSNP:1758362434"
variation 4
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/db_xref="dbSNP:1758362359"
variation 5
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="g"
/replace="t"
/db_xref="dbSNP:905355453"
variation 8
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:1175914538"
variation 9
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1250047881"
variation 10
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1021421570"
variation 13
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="g"
/db_xref="dbSNP:1480499072"
variation 16
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:1045196482"
variation 17..21
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="gc"
/replace="gcagc"
/db_xref="dbSNP:759941563"
variation 17
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="g"
/replace="t"
/db_xref="dbSNP:1369611613"
variation 18
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:1163596985"
variation 19
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="t"
/db_xref="dbSNP:1758361351"
variation 20
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1758361278"
variation 22
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:547717622"
variation 24
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1758361036"
variation 25
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/db_xref="dbSNP:989144837"
variation 26
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:754226468"
variation 27
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="g"
/db_xref="dbSNP:1581280766"
variation 32
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/db_xref="dbSNP:1758360785"
variation 33
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/db_xref="dbSNP:955911378"
variation 35
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="g"
/replace="t"
/db_xref="dbSNP:1758360627"
variation 36
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1758360553"
variation 40
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1581280763"
variation 41
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1758360392"
variation 46
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1314528207"
variation 52
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:1035371417"
variation 59
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1232554205"
variation 63
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1758359892"
variation 67
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1758359817"
variation 69
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:532547488"
variation 71
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1320150106"
variation 74
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:143945720"
variation 75
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1758359410"
variation 76
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1758359329"
variation 81
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="t"
/db_xref="dbSNP:1232585543"
variation 82
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:1023127531"
variation 88
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1479780361"
variation 89
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="g"
/db_xref="dbSNP:1758359007"
misc_feature 90..92
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/note="upstream in-frame stop codon"
variation 90
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="g"
/replace="t"
/db_xref="dbSNP:1758358943"
variation 93
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1758358864"
variation 94
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1561721185"
variation 97
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1304770169"
variation 104
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:2113242218"
variation 105
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1257226986"
variation 106
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="t"
/db_xref="dbSNP:1390650999"
variation 108
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1475178777"
variation 110
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1758358327"
variation 114
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1758358240"
variation 116
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1581280731"
variation 117
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:935313905"
variation 124
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="g"
/replace="t"
/db_xref="dbSNP:1426369736"
variation 125
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1758357938"
variation 131
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1466776972"
variation 132
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:1170517393"
variation 134
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="t"
/db_xref="dbSNP:1758357646"
variation 142
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="g"
/replace="t"
/db_xref="dbSNP:188425674"
variation 145
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1758357449"
variation 149
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1758357343"
variation 150
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1758357255"
variation 152
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1460101027"
variation 155
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:2113242122"
variation 156
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1758356592"
variation 159
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/db_xref="dbSNP:1561721159"
variation 161
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:368990128"
variation 163
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="g"
/db_xref="dbSNP:1758356294"
variation 166
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:780793965"
variation 167
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:374766084"
variation 170
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:751456302"
variation 171
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:371444949"
variation 175
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:1348101291"
variation 177
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:758461295"
variation 178
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/db_xref="dbSNP:1581280702"
variation 179
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:201195699"
variation 180
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:202033105"
variation 189
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/db_xref="dbSNP:1561721127"
variation 190
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:762053754"
variation 191..192
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="cc"
/db_xref="dbSNP:747120472"
variation 191
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:777002161"
variation 193
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:764375828"
variation 195
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:761175309"
variation 196
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1758354837"
variation 197
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1319071809"
variation 199
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="g"
/replace="t"
/db_xref="dbSNP:1037839885"
variation 206
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:140181319"
variation 209
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="g"
/db_xref="dbSNP:1758354449"
CDS 210..1511
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/note="isoform c is encoded by transcript variant 3;
activator protein 2; AP-2 transcription factor; activating
enhancer-binding protein 2-alpha; transcription factor
AP-2 alpha (activating enhancer binding protein 2 alpha)"
/codon_start=1
/product="transcription factor AP-2-alpha isoform c"
/protein_id="NP_001035890.1"
/db_xref="CCDS:CCDS43422.1"
/db_xref="GeneID:7020"
/db_xref="HGNC:HGNC:11742"
/db_xref="MIM:107580"
/translation="
MSILAKMGDWQDRHDGTSNGTARLPQLGTVGQSPYTSAPPLSHTPNADFQPPYFPPPYQPIYPQSQDPYSHVNDPYSLNPLHAQPQPQHPGWPGQRQSQESGLLHTHRGLPHQLSGLDPRRDYRRHEDLLHGPHALSSGLGDLSIHSLPHAIEEVPHVEDPGINIPDQTVIKKGPVSLSKSNSNAVSAIPINKDNLFGGVVNPNEVFCSVPGRLSLLSSTSKYKVTVAEVQRRLSPPECLNASLLGGVLRRAKSKNGGRSLREKLDKIGLNLPAGRRKAANVTLLTSLVEGEAVHLARDFGYVCETEFPAKAVAEFLNRQHSDPNEQVTRKNMLLATKQICKEFTDLLAQDRSPLGNSRPNPILEPGIQSCLTHFNLISHGFGSPAVCAAVTALQNYLTEALKAMDKMYLSNNPNSHTDNNAKSSDKEEKHRK"
misc_feature 828..1412
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/note="Transcription factor AP-2; Region: TF_AP-2;
pfam03299"
/db_xref="CDD:397406"
variation 213
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:772759043"
variation 216
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/db_xref="dbSNP:762523527"
variation 217
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1256981736"
variation 218
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:772884092"
variation 219
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1197173500"
variation 225
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:769526609"
variation 227
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1561721086"
variation 228
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="t"
/db_xref="dbSNP:747769835"
variation 230
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="g"
/replace="t"
/db_xref="dbSNP:2113241917"
variation 231
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:1422923319"
variation 232
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:780973352"
variation 234
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1758353327"
exon 243..677
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/inference="alignment:Splign:2.1.0"
variation 243
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1390260109"
variation 245
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1159407246"
variation 247
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="g"
/replace="t"
/db_xref="dbSNP:1757905667"
variation 251
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1757905534"
variation 255
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1031902856"
variation 256
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:143258135"
variation 266
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1409558696"
variation 267
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:1158262777"
variation 268
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="g"
/db_xref="dbSNP:904947516"
variation 269
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1757904436"
variation 271
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:1480723872"
variation 272
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="g"
/db_xref="dbSNP:1757904147"
variation 273
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1247903803"
variation 278
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:768948369"
variation 285
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1757903817"
variation 286
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1417791100"
variation 287
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="g"
/db_xref="dbSNP:1757903685"
variation 288
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1581269806"
variation 293
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="g"
/db_xref="dbSNP:1757903461"
variation 294
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:9368354"
variation 297
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:2113205023"
variation 298
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:780216169"
variation 301
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="g"
/replace="t"
/db_xref="dbSNP:772479857"
variation 302
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="g"
/replace="t"
/db_xref="dbSNP:746272068"
variation 306
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="t"
/db_xref="dbSNP:1468852747"
variation 307
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:779448987"
variation 308
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="t"
/db_xref="dbSNP:757798850"
variation 309
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1324911573"
variation 310
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/db_xref="dbSNP:1277168345"
variation 314
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1757902251"
variation 316
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1231120267"
variation 317
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:752157129"
variation 321
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="g"
/replace="t"
/db_xref="dbSNP:373246714"
variation 325
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:1757901650"
variation 330
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:754562525"
variation 331
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:751224702"
variation 332
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:149126243"
variation 337
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/db_xref="dbSNP:762787739"
variation 339..367
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace=""
/replace="acccccaatgccgacttccagcccccata"
/db_xref="dbSNP:760031321"
variation 339
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:750226796"
variation 340..375
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="ccccc"
/replace="cccccaatgccgacttccagcccccatacttccccc"
/db_xref="dbSNP:760747203"
variation 340..344
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="ccccc"
/replace="ccccccc"
/db_xref="dbSNP:753073720"
variation 340
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:765183722"
variation 341..374
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="cccc"
/replace="ccccaatgccgacttccagcccccatacttcccc"
/db_xref="dbSNP:771112431"
variation 341..363
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="cccc"
/replace="ccccaatgccgacttccagcccc"
/db_xref="dbSNP:765723158"
variation 341
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:1477406084"
variation 342..373
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="ccc"
/replace="cccaatgccgacttccagcccccatacttccc"
/db_xref="dbSNP:776903888"
variation 342
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1373206188"
variation 343
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:761863117"
variation 344
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1463271268"
variation 345
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/db_xref="dbSNP:776792762"
variation 346
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:527785340"
variation 347
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="t"
/db_xref="dbSNP:2113204676"
variation 348
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="g"
/db_xref="dbSNP:760904143"
variation 351
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1443395951"
variation 352
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/db_xref="dbSNP:775764363"
variation 354
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:772228476"
variation 355
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="g"
/replace="t"
/db_xref="dbSNP:1757899328"
variation 358
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="aa"
/db_xref="dbSNP:34436436"
variation 358
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/db_xref="dbSNP:868399679"
variation 360
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/db_xref="dbSNP:1199306870"
variation 362
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:746209784"
variation 365
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/db_xref="dbSNP:779173083"
variation 367
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/db_xref="dbSNP:1581269632"
variation 368
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:771371649"
variation 369
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="g"
/replace="t"
/db_xref="dbSNP:2113204530"
variation 370
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:749803917"
variation 371
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:1297198582"
variation 374
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1270082486"
variation 376
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/db_xref="dbSNP:778321721"
variation 377
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/db_xref="dbSNP:754476051"
variation 378
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/db_xref="dbSNP:931478101"
variation 380
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1360748940"
variation 381
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="g"
/replace="t"
/db_xref="dbSNP:2113204403"
variation 382
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/db_xref="dbSNP:746550070"
variation 386
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:779727040"
variation 389
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1396508200"
variation 392
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1757896570"
variation 393
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1757896452"
variation 394
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:758018662"
variation 396
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1757896219"
variation 398
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:1447190824"
variation 399
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="g"
/db_xref="dbSNP:750185451"
variation 402
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="t"
/db_xref="dbSNP:2113204293"
variation 403
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:2113204278"
variation 404
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:765135263"
variation 408
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="g"
/replace="t"
/db_xref="dbSNP:2113204253"
variation 410
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="t"
/db_xref="dbSNP:560684169"
variation 411
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:753822419"
variation 412
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/db_xref="dbSNP:2113204218"
variation 417
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="t"
/db_xref="dbSNP:764184708"
variation 419
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="g"
/db_xref="dbSNP:760782033"
variation 420
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1442384775"
variation 422
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1757895008"
variation 423
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1193218173"
variation 427
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1757894792"
variation 428
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="g"
/db_xref="dbSNP:775468691"
variation 429
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="g"
/replace="t"
/db_xref="dbSNP:1757894587"
variation 430
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/db_xref="dbSNP:1581269498"
variation 432
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="g"
/db_xref="dbSNP:1207350614"
variation 433
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="g"
/db_xref="dbSNP:1064797321"
variation 436
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1340179779"
variation 437
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:767736500"
variation 439
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="g"
/replace="t"
/db_xref="dbSNP:2113204087"
variation 441
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1581269470"
variation 445
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/db_xref="dbSNP:1581269462"
variation 447
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="g"
/db_xref="dbSNP:1229159576"
variation 448
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:200131527"
variation 449
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:774713482"
variation 450
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:376101872"
variation 453
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1708305061"
variation 455
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:545067807"
variation 456
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1309820486"
variation 459..474
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="cagccgcagccgcagc"
/replace="cagccgcagccgcagccgcagc"
/db_xref="dbSNP:2113203914"
variation 461
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1427256978"
variation 462
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1757892559"
variation 463
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="g"
/db_xref="dbSNP:1369464081"
variation 464
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:773687604"
variation 470
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:770326832"
variation 473
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1416363403"
variation 475
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:1757891946"
variation 479
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1047602511"
variation 486
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:746489683"
variation 487
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:779455245"
variation 488
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:758008816"
variation 489
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="g"
/db_xref="dbSNP:920462082"
variation 494
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="g"
/db_xref="dbSNP:372468982"
variation 496
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="g"
/db_xref="dbSNP:778774564"
variation 498..506
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="cagagccag"
/replace="cagagccagagccag"
/db_xref="dbSNP:2113203786"
variation 500
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1222500719"
variation 503
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:757104358"
variation 506
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1757890544"
variation 510
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="g"
/replace="t"
/db_xref="dbSNP:1757890428"
variation 513
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:753730365"
variation 514
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:1227500007"
variation 517
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="g"
/replace="t"
/db_xref="dbSNP:1757889922"
variation 519
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:764088571"
variation 520
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="t"
/db_xref="dbSNP:756034130"
variation 524
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1757889484"
variation 525
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1407939076"
variation 527
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1349267381"
variation 528..546
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="cacc"
/replace="caccgggggctgcctcacc"
/db_xref="dbSNP:1757886808"
variation 532
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:1757889083"
variation 533
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:138225261"
variation 534
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:767502053"
variation 536
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:916984716"
variation 537
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:563009991"
variation 538
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1581269305"
variation 547
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1405134828"
variation 550
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1490019573"
variation 551
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:544933565"
variation 553
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1161927231"
variation 554
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:766641930"
variation 557
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/db_xref="dbSNP:1251119942"
variation 558
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1757885976"
variation 562
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1234156913"
variation 568
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:763273543"
variation 569
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/db_xref="dbSNP:145673154"
variation 571
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1405346146"
variation 575
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="g"
/db_xref="dbSNP:200574824"
variation 576
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:748618587"
variation 577
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:774997299"
variation 578
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1269794638"
variation 579
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/db_xref="dbSNP:1757884757"
variation 580
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1757884640"
variation 582
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/db_xref="dbSNP:992510243"
variation 583
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1757884401"
variation 584
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:979506886"
variation 587
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/db_xref="dbSNP:771478009"
variation 593..598
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="cct"
/replace="cctcct"
/db_xref="dbSNP:1757883873"
variation 597
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1220419935"
variation 598..604
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="tgcacgg"
/replace="tgcacggtgcacgg"
/db_xref="dbSNP:1554112492"
variation 598
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:968299826"
variation 599
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="g"
/replace="t"
/db_xref="dbSNP:1292566817"
variation 600
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1757883501"
variation 602
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:745441531"
variation 603
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="g"
/db_xref="dbSNP:1647693167"
variation 605
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1389756739"
variation 611
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:778686750"
variation 612
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1757882910"
variation 613
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/db_xref="dbSNP:770743434"
variation 614
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1411833729"
variation 616
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:111353850"
variation 617
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:369051842"
variation 619
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:2113203119"
variation 621
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1009464114"
variation 623
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:1581269159"
variation 624
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="g"
/db_xref="dbSNP:1757882119"
variation 626
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:777729482"
variation 627
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1190763496"
variation 630..631
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="gg"
/replace="ggg"
/db_xref="dbSNP:1757881738"
variation 632
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/db_xref="dbSNP:756019412"
variation 635
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1757881477"
variation 637
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1336225760"
variation 638
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1757881231"
variation 640
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="g"
/db_xref="dbSNP:1453679490"
variation 641
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="g"
/replace="t"
/db_xref="dbSNP:747353442"
variation 643
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="t"
/db_xref="dbSNP:1206569048"
variation 645
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1464302120"
variation 647
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:752575373"
variation 649
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="g"
/db_xref="dbSNP:555997980"
variation 654..655
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace=""
/replace="t"
/db_xref="dbSNP:952730038"
variation 658
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="t"
/db_xref="dbSNP:754995203"
variation 659
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:375321728"
variation 660
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1034685390"
variation 662
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1291571869"
variation 663
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:751678511"
variation 664
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1366944925"
variation 665
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="g"
/db_xref="dbSNP:1295010353"
variation 666
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:1001826033"
variation 670
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="t"
/db_xref="dbSNP:1437702443"
variation 671
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:766548263"
variation 672
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1384770887"
variation 674
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1180549798"
variation 676
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:1303880752"
exon 678..729
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/inference="alignment:Splign:2.1.0"
variation 678
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="g"
/db_xref="dbSNP:1581265575"
variation 680
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:758551492"
variation 681
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:540208578"
variation 684
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="g"
/db_xref="dbSNP:1581265556"
variation 688
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:111681798"
variation 689
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/db_xref="dbSNP:1757737398"
variation 690
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/db_xref="dbSNP:890498550"
variation 691
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:765549775"
variation 692
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:762057151"
variation 693
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:1449365849"
variation 694
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:754264393"
variation 698
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="g"
/replace="t"
/db_xref="dbSNP:528101301"
variation 703
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1757736406"
variation 709
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1354299682"
variation 712
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:1757736120"
variation 724
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="t"
/db_xref="dbSNP:1321006396"
variation 725
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:559183946"
exon 730..961
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/inference="alignment:Splign:2.1.0"
variation 731
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/db_xref="dbSNP:1193052197"
variation 732
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1443522039"
variation 734
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:531975577"
variation 735
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1208782432"
variation 739
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1757621475"
variation 742
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:764532449"
variation 743..754
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="gtccaa"
/replace="gtccaagtccaa"
/db_xref="dbSNP:771955798"
variation 743
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:1041684112"
variation 745
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/db_xref="dbSNP:146735451"
variation 746
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:1230910073"
variation 748
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1561709465"
variation 749
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1052818666"
variation 753
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:201296512"
variation 754
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1757620122"
variation 757
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1167211530"
variation 760
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:565071190"
variation 763
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="g"
/db_xref="dbSNP:1435982863"
variation 764
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1342169742"
variation 765
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1332158151"
variation 766
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1339506384"
variation 770
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:143363077"
variation 771
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="g"
/replace="t"
/db_xref="dbSNP:1284597921"
variation 772
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:2114014890"
variation 774
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:772810778"
variation 776
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/db_xref="dbSNP:1757618923"
variation 777
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:764751482"
variation 780
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1757618688"
variation 782
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="g"
/replace="t"
/db_xref="dbSNP:761543465"
variation 785
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/db_xref="dbSNP:925135582"
variation 788
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:372587710"
variation 789
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:2114014809"
variation 791
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="g"
/db_xref="dbSNP:1757617866"
variation 792
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:768437372"
variation 797
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:746862188"
variation 799
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="g"
/replace="t"
/db_xref="dbSNP:1757617197"
variation 800
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:772033707"
variation 803
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:745892262"
variation 804
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="g"
/db_xref="dbSNP:1757616532"
variation 805
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:763437712"
variation 806
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1252638687"
variation 807..812
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="gtg"
/replace="gtggtg"
/db_xref="dbSNP:1228645049"
variation 807
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1207517084"
variation 810
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:1306008241"
variation 812
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1272630405"
variation 820
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:202002859"
variation 821
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1282344497"
variation 824
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1440885205"
variation 825
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:749528750"
variation 827
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="g"
/db_xref="dbSNP:777922831"
variation 832
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:909713555"
variation 835
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:979214687"
variation 837
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1561709246"
variation 838
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="t"
/db_xref="dbSNP:793888541"
variation 841
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:2114014597"
variation 842
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:2114014584"
variation 846
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/db_xref="dbSNP:793888540"
variation 847
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="g"
/replace="t"
/db_xref="dbSNP:1554111768"
variation 848
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:756526526"
variation 851
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:369302647"
variation 854
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1455248490"
variation 857
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/db_xref="dbSNP:1757613362"
variation 866
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1757613170"
variation 868
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1341138385"
variation 870
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:768098328"
variation 872
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:755569103"
variation 875
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:921657783"
variation 878
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="g"
/db_xref="dbSNP:2114014460"
variation 881
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:1319837727"
variation 882
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:749849069"
variation 884
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="g"
/db_xref="dbSNP:764811179"
variation 886
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1757611467"
variation 887
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:1163314557"
variation 891
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1757611000"
variation 893
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:975728119"
variation 894
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1554111751"
variation 899
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1475187781"
variation 901
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="t"
/db_xref="dbSNP:1757610159"
variation 903
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1554111749"
variation 904
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="g"
/db_xref="dbSNP:2114014389"
variation 905
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:761298686"
variation 906
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="g"
/db_xref="dbSNP:151344524"
variation 907
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:151344525"
variation 908
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:554807432"
variation 909
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:1479723294"
variation 910
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1554111734"
variation 912
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:2114014341"
variation 913
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1274356477"
variation 914
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/db_xref="dbSNP:763782805"
variation 915
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="g"
/db_xref="dbSNP:1222662376"
variation 916
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/db_xref="dbSNP:1453058626"
variation 920
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:140905560"
variation 921
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:151344526"
variation 923
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:151009833"
variation 924
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:1232550960"
variation 925
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:1561709016"
variation 927
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:929697206"
variation 929
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:1290180108"
variation 930
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:2114014223"
variation 932
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1207216619"
variation 935
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:1221567277"
variation 938
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:1372051364"
variation 941
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:918362351"
variation 942
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:2114014171"
variation 943
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1581262652"
variation 945
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:976420342"
variation 946
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1554111717"
variation 947
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="g"
/db_xref="dbSNP:1438168312"
variation 949
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:151344527"
variation 950
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:2114014100"
variation 956
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:142511319"
variation 957
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:151344528"
variation 958
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:151344530"
variation 959
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:912110615"
variation 960
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:121909574"
exon 962..1080
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/inference="alignment:Splign:2.1.0"
variation 964
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:151344531"
variation 965
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1762051471"
variation 968
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1561707145"
variation 979
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:2114007535"
variation 982
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:121909575"
variation 988
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:781630462"
variation 990
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:769053661"
variation 996
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="g"
/db_xref="dbSNP:747379877"
variation 1002
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="g"
/db_xref="dbSNP:758652364"
variation 1005
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="g"
/db_xref="dbSNP:1762050654"
variation 1007
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1298229232"
variation 1011
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1762050441"
variation 1012
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1380933178"
variation 1017
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:35008125"
variation 1021
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1304000210"
variation 1023
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:758856518"
variation 1032
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1248995629"
variation 1037
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1373721108"
variation 1038
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1762049566"
variation 1042
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/db_xref="dbSNP:1334796537"
variation 1049
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:753291798"
variation 1051
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:1021266565"
variation 1052
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:777278396"
variation 1053
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:755697313"
variation 1061
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1561707036"
variation 1062
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:750843820"
variation 1064
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1427749956"
variation 1067
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1385271833"
variation 1070
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1762048071"
variation 1074
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:1230671196"
variation 1076
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:1256777391"
variation 1079
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1161265522"
exon 1081..1222
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/inference="alignment:Splign:2.1.0"
variation 1083
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:267607108"
variation 1086
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="g"
/db_xref="dbSNP:1554110994"
variation 1088
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:771879686"
variation 1094
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:1291410371"
variation 1095
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1017546454"
variation 1100
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/db_xref="dbSNP:745607212"
variation 1109
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:369463773"
variation 1112
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:778860533"
variation 1115
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:141711078"
variation 1116
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:377114324"
variation 1121
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:771617050"
variation 1122
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:756122879"
variation 1126..1127
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="cc"
/replace="ccc"
/db_xref="dbSNP:1581257862"
variation 1126
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:752860081"
variation 1127
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1201428666"
variation 1128
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:2114003030"
variation 1129
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/db_xref="dbSNP:144275164"
variation 1133
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1761969115"
variation 1139
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:1761968960"
variation 1144
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:1761968853"
variation 1145
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:767678528"
variation 1156
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="g"
/replace="t"
/db_xref="dbSNP:1347573125"
variation 1158
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="g"
/db_xref="dbSNP:1232638969"
variation 1160
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1803117"
variation 1162
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:759768857"
variation 1164
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1761968190"
variation 1168
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:751854479"
variation 1169
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:766726105"
variation 1172
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="g"
/replace="t"
/db_xref="dbSNP:763437006"
variation 1174
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="g"
/db_xref="dbSNP:1277818334"
variation 1175
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1468822086"
variation 1176
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:575186761"
variation 1179
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1233128354"
variation 1180
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1761967264"
variation 1183
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:902671328"
variation 1184
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:770375179"
variation 1194
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1761966876"
variation 1199..1204
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="aaaaaa"
/replace="aaaaaaa"
/db_xref="dbSNP:1581257777"
variation 1207
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1047029652"
variation 1209
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1271181704"
variation 1211
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1761966494"
variation 1212
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:760066655"
variation 1214
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1581257762"
variation 1220
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1561705463"
variation 1221
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1761966097"
exon 1223..3251
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/inference="alignment:Splign:2.1.0"
variation 1223
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:758672228"
variation 1224
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="g"
/db_xref="dbSNP:750693033"
variation 1229
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:765634102"
variation 1230
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1761890567"
variation 1233..1235
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="aaa"
/db_xref="dbSNP:1554110735"
variation 1233
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:1761890440"
variation 1240
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="t"
/db_xref="dbSNP:757626207"
variation 1241
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:754379873"
variation 1242
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1761889946"
variation 1244
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:140377026"
variation 1245
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="g"
/replace="t"
/db_xref="dbSNP:1298300281"
variation 1254
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:759083592"
variation 1262
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:774029144"
variation 1263
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="g"
/db_xref="dbSNP:9350373"
variation 1264
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:765898042"
variation 1265
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:762671343"
variation 1266
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:1761888842"
variation 1269
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:772807658"
variation 1271
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:375372321"
variation 1272
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1462249987"
variation 1275
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="g"
/db_xref="dbSNP:1761888273"
variation 1277
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="g"
/replace="t"
/db_xref="dbSNP:1210545030"
variation 1279
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:747986718"
variation 1280
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1761887746"
variation 1285
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1761887576"
variation 1286
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:2113998133"
variation 1290
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:1479064980"
variation 1291
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:776521790"
variation 1292
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1427874803"
variation 1293
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="g"
/db_xref="dbSNP:1761886675"
variation 1296
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1418554694"
variation 1299
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1189414319"
variation 1302
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="g"
/db_xref="dbSNP:1188838299"
variation 1307
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:372082918"
variation 1308
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:1761885626"
variation 1311
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1761885515"
variation 1320
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="t"
/replace="tt"
/db_xref="dbSNP:1561704106"
variation 1321
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:768613709"
variation 1322
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1196033476"
variation 1323
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1761885064"
variation 1326
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/db_xref="dbSNP:1581255924"
variation 1327
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:747045958"
variation 1336
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1761884708"
variation 1337
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:780192295"
variation 1338
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:2113997976"
variation 1340
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:372299435"
variation 1343
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:550611281"
variation 1344
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="t"
/db_xref="dbSNP:1274422034"
variation 1349
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:935971227"
variation 1355
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:779059756"
variation 1360
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1761883898"
variation 1361
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="g"
/db_xref="dbSNP:1165787572"
variation 1362
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1353656280"
variation 1364
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="g"
/db_xref="dbSNP:2113997918"
variation 1367
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:757618280"
variation 1369
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1761883527"
variation 1372
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:754293607"
variation 1373
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:2113997896"
variation 1374
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="g"
/replace="t"
/db_xref="dbSNP:778384375"
variation 1376
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:181105841"
variation 1378
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:905854185"
variation 1379
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:765909703"
variation 1380
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="g"
/replace="t"
/db_xref="dbSNP:1395122023"
variation 1382
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="g"
/db_xref="dbSNP:762430867"
variation 1383
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:750068981"
variation 1384
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:1367388357"
variation 1385
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:2230116"
variation 1391
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1761879705"
variation 1392
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/db_xref="dbSNP:1761879575"
variation 1394
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:1420479673"
variation 1397
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/db_xref="dbSNP:1325930703"
variation 1399
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1248028062"
variation 1403
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="g"
/db_xref="dbSNP:200847258"
variation 1404
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:1581255795"
variation 1406
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:201494266"
variation 1407
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1274286799"
variation 1412
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/db_xref="dbSNP:1338181328"
variation 1417
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/db_xref="dbSNP:1052198371"
variation 1424
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1216098518"
variation 1427
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="g"
/db_xref="dbSNP:1761878075"
variation 1432
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="g"
/replace="t"
/db_xref="dbSNP:1332712198"
variation 1435..1445
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="acctcagcaac"
/replace="acctcagcaacctcagcaac"
/db_xref="dbSNP:760836149"
variation 1435
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:1487162743"
variation 1445
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1761877545"
variation 1447
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/db_xref="dbSNP:1239924038"
variation 1450
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:867726953"
variation 1453
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:201591227"
variation 1454
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:3734391"
variation 1456
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:772175937"
variation 1460
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:745981703"
variation 1462
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1761876463"
variation 1463
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1761876332"
variation 1464
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:771307700"
variation 1470
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/db_xref="dbSNP:1581255703"
variation 1472
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:749620758"
variation 1474
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1803116"
variation 1476
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1761875652"
variation 1480
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:778294642"
variation 1481
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1454954313"
variation 1482
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:756614321"
variation 1491..1496
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="gag"
/replace="gaggag"
/db_xref="dbSNP:773291481"
variation 1493
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:374310228"
variation 1494
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:781601001"
variation 1511
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace=""
/replace="a"
/db_xref="dbSNP:1761873980"
variation 1511
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1554110673"
variation 1513
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:757896248"
variation 1515
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:749936793"
variation 1516
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:764897160"
variation 1517
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:761472794"
variation 1518
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:753566744"
variation 1519
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1259126090"
variation 1520
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:763868660"
variation 1521..1523
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="cc"
/replace="ccc"
/db_xref="dbSNP:767561818"
variation 1521
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:760518852"
variation 1523
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:775472363"
variation 1524
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:1393005080"
variation 1525..1528
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="cccc"
/replace="cccccccccc"
/db_xref="dbSNP:1330444356"
variation 1527
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1761872544"
variation 1528
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1231856814"
variation 1529
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="g"
/db_xref="dbSNP:968780292"
variation 1530
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:771942212"
variation 1534
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1021755301"
variation 1535
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:371339437"
variation 1537
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/db_xref="dbSNP:552520811"
variation 1538
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/db_xref="dbSNP:1304029829"
variation 1540
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:771219549"
variation 1543
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1581255612"
variation 1546..1547
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="cc"
/replace="cccc"
/db_xref="dbSNP:761920926"
variation 1546
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1434970906"
variation 1548
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/db_xref="dbSNP:1581255604"
variation 1549
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1761871004"
variation 1550..1555
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="ccccc"
/replace="cccccc"
/replace="ccccccc"
/db_xref="dbSNP:774267757"
variation 1550
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:749517602"
variation 1551
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:778198576"
variation 1552
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/db_xref="dbSNP:770263013"
variation 1553
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:1377549684"
variation 1554
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:748502364"
variation 1555
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:781698007"
variation 1556
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:1260664295"
variation 1557
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:1261168096"
variation 1559
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1216105724"
variation 1560
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:755465363"
variation 1563
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:925002147"
variation 1564
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/db_xref="dbSNP:530677405"
variation 1568
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1581255532"
variation 1569
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:563344990"
variation 1570
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1377300959"
variation 1572..1573
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace=""
/replace="tgacaccctc"
/db_xref="dbSNP:1363190893"
variation 1574
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1455690395"
variation 1576
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="g"
/replace="t"
/db_xref="dbSNP:1167248049"
variation 1577
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="g"
/replace="t"
/db_xref="dbSNP:542047656"
variation 1579
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="t"
/db_xref="dbSNP:1761868708"
variation 1580
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:1246232305"
variation 1581
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1581255504"
variation 1587..1589
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="gg"
/replace="ggg"
/db_xref="dbSNP:1461180426"
variation 1592
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:369680359"
variation 1595
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/db_xref="dbSNP:574832806"
variation 1597
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:1375726110"
variation 1598
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="g"
/db_xref="dbSNP:1392335736"
variation 1599
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:10456013"
variation 1601..1602
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace=""
/replace="tt"
/db_xref="dbSNP:1761867613"
variation 1603
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:541008118"
variation 1604..1631
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="ctgctgctgctactgctgctgctgctgc"
/replace="ctgctgctgctactgctgctgctgctgctgctactgctgctgctgctg
c"
/db_xref="dbSNP:2113996958"
variation 1604..1626
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="ctgctgctgct"
/replace="ctgctgctgctactgctgctgct"
/replace="ctgctgctgctactgctgctgctactgctgctgct"
/db_xref="dbSNP:1189972431"
variation 1604..1614
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="ctgctgctgct"
/replace="ctgctgctgctgct"
/replace="ctgctgctgctgctgct"
/replace="ctgctgctgctgctgctgct"
/db_xref="dbSNP:1761866292"
variation 1604
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1761867306"
variation 1606
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="g"
/db_xref="dbSNP:976392453"
variation 1607..1623
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="ctgctgct"
/replace="ctgctgctactgctgct"
/db_xref="dbSNP:1177590362"
variation 1609
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="g"
/db_xref="dbSNP:936995435"
variation 1610
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1199107159"
variation 1611
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1761866690"
variation 1612
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="g"
/db_xref="dbSNP:1761866540"
variation 1613..1617
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="ct"
/replace="ctact"
/replace="ctactact"
/db_xref="dbSNP:1212463749"
variation 1614
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1761866183"
variation 1615
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:909590607"
variation 1616..1631
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="ctgc"
/replace="ctgctgctgc"
/replace="ctgctgctgctgc"
/replace="ctgctgctgctgctgc"
/replace="ctgctgctgctgctgctgc"
/replace="ctgctgctgctgctgctgctgc"
/replace="ctgctgctgctgctgctgctgctgc"
/replace="ctgctgctgctgctgctgctgctgctgctgc"
/db_xref="dbSNP:rs1264691695"
variation 1617
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1761865799"
variation 1618
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1761865688"
variation 1620
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1761865592"
variation 1622
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="g"
/db_xref="dbSNP:985440269"
variation 1623
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1344734284"
variation 1624..1634
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="gctgctgccgc"
/replace="gctgctgccgctgctgccgc"
/db_xref="dbSNP:1761864152"
variation 1626
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1280678804"
variation 1627..1653
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="gctgccgccgccgccgccgccgctgcc"
/replace="gctgccgccgccgccgccgccgctgccgccgccgccgccgccgctgcc
"
/db_xref="dbSNP:1761862191"
variation 1627..1637
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="gc"
/replace="gctgccgccgc"
/db_xref="dbSNP:1761863747"
variation 1627..1634
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="gc"
/replace="gctgccgc"
/db_xref="dbSNP:1761864046"
variation 1628
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1638752662"
variation 1629
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:952359971"
variation 1630..1649
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="gccgccgc"
/replace="gccgccgccgc"
/replace="gccgccgccgccgc"
/replace="gccgccgccgccgccgc"
/replace="gccgccgccgccgccgccgc"
/replace="gccgccgccgccgccgccgccgc"
/replace="gccgccgccgccgccgccgccgccgc"
/replace="gccgccgccgccgccgccgccgccgccgc"
/replace="gccgccgccgccgccgccgccgccgccgccgc"
/replace="gccgccgccgccgccgccgccgccgccgccgccgc"
/db_xref="dbSNP:rs952111195"
variation 1630..1631
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="gc"
/replace="gctgccgc"
/db_xref="dbSNP:1761864354"
variation 1630
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="g"
/replace="t"
/db_xref="dbSNP:1761864764"
variation 1632
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1561703542"
variation 1634
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1761863938"
variation 1635
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1394779030"
variation 1637
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:764664664"
variation 1638
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:188674648"
variation 1639..1653
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="gccgccgccgctgcc"
/replace="gccgccgccgctgccgccgccgctgcc"
/db_xref="dbSNP:1761862106"
variation 1639
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:759057111"
variation 1640..1644
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="ccgcc"
/replace="ccgcccgcc"
/db_xref="dbSNP:1204736976"
variation 1641
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1355313097"
variation 1642..1653
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="gcc"
/replace="gccgccgctgcc"
/replace="gccgccgctgccgccgctgcc"
/db_xref="dbSNP:1024708087"
variation 1642
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:966069097"
variation 1643
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="g"
/db_xref="dbSNP:1309903650"
variation 1644
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:1308939096"
variation 1645..1653
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="gcc"
/replace="gccgctgcc"
/replace="gccgctgccgctgcc"
/db_xref="dbSNP:1013473016"
variation 1648..1652
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="gc"
/replace="gctgc"
/replace="gctgctgc"
/db_xref="dbSNP:1328138243"
variation 1649
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/db_xref="dbSNP:558781203"
variation 1650
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1461010"
variation 1651..1653
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="gcc"
/replace="gccgcc"
/db_xref="dbSNP:1363447437"
variation 1653
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1313831421"
variation 1654
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:896380071"
variation 1655
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1332048106"
variation 1658
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:1052230470"
variation 1659
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1761861137"
variation 1661..1666
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="cccccc"
/replace="ccccccc"
/db_xref="dbSNP:879600114"
variation 1661
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:576370374"
variation 1662..1663
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace=""
/replace="t"
/db_xref="dbSNP:1761861031"
variation 1663..1671
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="ccccgagtc"
/db_xref="dbSNP:2113996639"
variation 1663
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:1043516659"
variation 1664
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1761860797"
variation 1665
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1761860675"
variation 1666
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/db_xref="dbSNP:1375834719"
variation 1668
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1185939128"
variation 1672
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1246458258"
variation 1674
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:1033048391"
variation 1675
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:931711956"
variation 1677
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="g"
/replace="t"
/db_xref="dbSNP:554863655"
variation 1679
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:921640701"
variation 1680
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="t"
/db_xref="dbSNP:1761859073"
variation 1686
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1346245005"
variation 1688
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:1000507129"
variation 1692
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:903119541"
variation 1695
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1761858410"
variation 1696
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:1041913358"
variation 1698
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:2113996545"
variation 1699
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="g"
/replace="t"
/db_xref="dbSNP:1014105118"
variation 1705
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:865876939"
variation 1706
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1761857626"
variation 1708
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="t"
/db_xref="dbSNP:1346866545"
variation 1711..1725
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="ccg"
/replace="ccgactctgcacccg"
/db_xref="dbSNP:1761856474"
variation 1712
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1388509761"
variation 1714
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="t"
/db_xref="dbSNP:944946792"
variation 1716
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="t"
/db_xref="dbSNP:895531375"
variation 1717..1733
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="ctgcacccgcctcgacc"
/replace="ctgcacccgcctcgaccctgcacccgcctcgacc"
/db_xref="dbSNP:1035826843"
variation 1722..1724
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="cc"
/replace="ccc"
/db_xref="dbSNP:1761856802"
variation 1724
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1317405576"
variation 1725
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="g"
/replace="t"
/db_xref="dbSNP:1215190646"
variation 1726
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1761856116"
variation 1729
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1246244659"
variation 1730
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="g"
/replace="t"
/db_xref="dbSNP:1470023095"
variation 1733
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1761855461"
variation 1735
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="g"
/db_xref="dbSNP:1581255236"
variation 1736
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1475748486"
variation 1738
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:1055552867"
variation 1739
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="aa"
/db_xref="dbSNP:1761854721"
variation 1740
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1761854549"
variation 1743
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="g"
/replace="t"
/db_xref="dbSNP:1761854401"
variation 1745
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="t"
/db_xref="dbSNP:1477250710"
variation 1746
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:1179249633"
variation 1751
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/db_xref="dbSNP:1581255215"
variation 1752
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1761853775"
variation 1753
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="g"
/db_xref="dbSNP:1761853612"
variation 1754
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:536878759"
variation 1755
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="g"
/db_xref="dbSNP:1409391499"
variation 1765
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/db_xref="dbSNP:1761853109"
variation 1766
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="t"
/db_xref="dbSNP:2113996295"
variation 1767
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="g"
/replace="t"
/db_xref="dbSNP:1761852953"
variation 1770
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1761852844"
variation 1772
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1761852751"
variation 1775
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1400585644"
variation 1776..1777
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="aa"
/db_xref="dbSNP:920745965"
variation 1776
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:937109804"
variation 1777
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/db_xref="dbSNP:1761852420"
variation 1778
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:1326187998"
variation 1780
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1330081738"
variation 1782
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/db_xref="dbSNP:1761852211"
variation 1784
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:1761852095"
variation 1786..1787
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="aa"
/replace="aaa"
/db_xref="dbSNP:1761851996"
variation 1788
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1761851898"
variation 1794
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1434074194"
variation 1802
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1281025601"
variation 1803
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="g"
/replace="t"
/db_xref="dbSNP:1761851569"
variation 1804
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1374037010"
variation 1805..1810
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="agagaa"
/db_xref="dbSNP:1761851228"
variation 1808
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:118042860"
variation 1809..1812
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="aaaa"
/replace="aaaaa"
/db_xref="dbSNP:1761851119"
variation 1812
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/db_xref="dbSNP:1761851027"
variation 1813
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1266384437"
variation 1818..1819
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace=""
/replace="t"
/db_xref="dbSNP:1761850850"
variation 1820
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:980233072"
variation 1823
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:970522088"
variation 1827
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="g"
/replace="t"
/db_xref="dbSNP:1761850494"
variation 1828
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1761850399"
variation 1829
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="g"
/replace="t"
/db_xref="dbSNP:1024324181"
variation 1831
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/db_xref="dbSNP:1581255151"
variation 1832..1834
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="cc"
/replace="ccc"
/replace="cccc"
/db_xref="dbSNP:1761849862"
variation 1832
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1207089465"
variation 1833
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1761849958"
variation 1834..1836
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace=""
/replace="ctt"
/db_xref="dbSNP:992755911"
variation 1834
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1442243547"
variation 1835..1844
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="ttttttttt"
/replace="tttttttttt"
/replace="ttttttttttt"
/replace="tttttttttttt"
/replace="ttttttttttttt"
/db_xref="dbSNP:rs34512481"
variation 1835
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1470109641"
variation 1837
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1258624822"
variation 1838
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="g"
/replace="t"
/db_xref="dbSNP:868777552"
variation 1839
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="g"
/replace="t"
/db_xref="dbSNP:1164960101"
variation 1842
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1761849119"
variation 1843
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="t"
/db_xref="dbSNP:1761849023"
variation 1844
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="t"
/db_xref="dbSNP:960616888"
variation 1845..1851
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="aaa"
/replace="aaacaaa"
/db_xref="dbSNP:1357212931"
variation 1845..1847
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="aaa"
/replace="aaaa"
/db_xref="dbSNP:1030918433"
variation 1845
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="t"
/db_xref="dbSNP:1409192672"
variation 1847..1848
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace=""
/replace="g"
/db_xref="dbSNP:1554110541"
variation 1848
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/db_xref="dbSNP:2763172"
variation 1849..1852
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="aa"
/replace="aaaa"
/db_xref="dbSNP:2113995877"
variation 1851..1858
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="aacaa"
/replace="aacaacaa"
/db_xref="dbSNP:1761847545"
variation 1852
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1234009643"
variation 1853
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/db_xref="dbSNP:201528167"
variation 1854
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="t"
/db_xref="dbSNP:546690434"
variation 1856..1863
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="caa"
/replace="caaatcaa"
/db_xref="dbSNP:1761846942"
variation 1859..1862
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="atca"
/db_xref="dbSNP:1761847087"
variation 1859
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1761847443"
variation 1860
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1581255079"
variation 1861..1877
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="caacaaca"
/replace="caacaacagcaacaaca"
/db_xref="dbSNP:1761846273"
variation 1861..1868
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="caaca"
/replace="caacaaca"
/db_xref="dbSNP:903713519"
variation 1861
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1761847207"
variation 1866
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:999390920"
variation 1869
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:1273385395"
variation 1870..1884
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="caacaacaacaa"
/replace="caacaacaacaacaa"
/replace="caacaacaacaacaacaa"
/db_xref="dbSNP:34426547"
variation 1872
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1274221636"
variation 1873
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="g"
/db_xref="dbSNP:1761846476"
variation 1876
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1437626762"
variation 1879
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/db_xref="dbSNP:1761846164"
variation 1880..1895
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="aac"
/replace="aacaaaaattaaaaac"
/db_xref="dbSNP:1761845459"
variation 1882
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/db_xref="dbSNP:1214663204"
variation 1884
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/db_xref="dbSNP:1761845767"
variation 1885
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/db_xref="dbSNP:1761845674"
variation 1891
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1761845575"
variation 1895
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1761845358"
variation 1896..1901
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="ttttt"
/replace="tttttt"
/db_xref="dbSNP:2113995622"
variation 1896
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:9350372"
variation 1897
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:1188111555"
variation 1898
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1761844968"
variation 1903
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1761844855"
variation 1904..1912
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="aaaa"
/replace="aaaaaaaa"
/replace="aaaaaaaaa"
/replace="aaaaaaaaaa"
/db_xref="dbSNP:1022531195"
variation 1911
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/db_xref="dbSNP:1367350373"
variation 1912
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:534571057"
variation 1916..1924
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="aaaa"
/replace="aaaataaaa"
/db_xref="dbSNP:1761843691"
variation 1916..1919
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="aaa"
/replace="aaaa"
/db_xref="dbSNP:1761844226"
variation 1916
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/db_xref="dbSNP:1761844353"
variation 1918..1931
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="aataaaaaaaatta"
/db_xref="dbSNP:1761842740"
variation 1920
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="t"
/db_xref="dbSNP:1581254995"
variation 1921..1928
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="aaa"
/replace="aaaaa"
/replace="aaaaaaa"
/replace="aaaaaaaa"
/replace="aaaaaaaaa"
/db_xref="dbSNP:rs560622395"
variation 1921
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="t"
/db_xref="dbSNP:1419713131"
variation 1922
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/db_xref="dbSNP:1340848444"
variation 1928..1932
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="at"
/replace="attat"
/db_xref="dbSNP:1338770571"
variation 1929
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:762265236"
variation 1930
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:1377222122"
variation 1931
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:995958548"
variation 1932..1933
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace=""
/replace="gacc"
/db_xref="dbSNP:1761841994"
variation 1932
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1333638502"
variation 1934
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:1229630753"
variation 1936
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:900215570"
variation 1941
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1040063782"
variation 1942
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:944394499"
variation 1943
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:570465051"
variation 1946
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1761841008"
variation 1948
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1282888127"
variation 1949..1950
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace=""
/replace="tg"
/db_xref="dbSNP:1761840708"
variation 1950..1952
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="g"
/replace="gag"
/db_xref="dbSNP:1761840277"
variation 1950
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1349290262"
variation 1952
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1200386054"
variation 1953
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1581254923"
variation 1954
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:552459189"
variation 1955
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1761839658"
variation 1956
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1254939046"
variation 1958
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1761839464"
variation 1965..1975
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="ctt"
/replace="cttacatactt"
/db_xref="dbSNP:1761838826"
variation 1965
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1761839353"
variation 1967
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1761839272"
variation 1970
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:151315569"
variation 1972
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="aa"
/db_xref="dbSNP:930861855"
variation 1972
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1048035394"
variation 1974..1975
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="tt"
/replace="tttt"
/db_xref="dbSNP:1294929845"
variation 1975
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="t"
/db_xref="dbSNP:1761838640"
variation 1981
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/db_xref="dbSNP:1448450330"
variation 1985
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:1166534115"
variation 1986
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1396628089"
variation 1987
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:1435339410"
variation 1991
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="g"
/db_xref="dbSNP:1407693225"
variation 1993
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:1399896260"
variation 1996
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:1368962252"
variation 1997
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="t"
/db_xref="dbSNP:1328417565"
variation 1998
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:1410668347"
variation 1999..2013
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="aaaaaaaaa"
/replace="aaaaaaaaaa"
/replace="aaaaaaaaaaa"
/replace="aaaaaaaaaaaa"
/replace="aaaaaaaaaaaaa"
/replace="aaaaaaaaaaaaaa"
/replace="aaaaaaaaaaaaaaa"
/replace="aaaaaaaaaaaaaaaa"
/replace="aaaaaaaaaaaaaaaaa"
/replace="aaaaaaaaaaaaaaaaaa"
/replace="aaaaaaaaaaaaaaaaaaaaaaaaa"
/replace="aaaaaaaaaaaaaaaaaaaaaaaaaaa"
/db_xref="dbSNP:rs544361557"
variation 1999
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="t"
/db_xref="dbSNP:1761837499"
variation 2000
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:920790273"
variation 2010
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1761837258"
variation 2013
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1761836680"
variation 2014
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1206398486"
variation 2015
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/db_xref="dbSNP:1581254834"
variation 2017
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1464190357"
variation 2018
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1761836312"
variation 2020
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1761836226"
variation 2021
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1581254826"
variation 2022
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:1761836023"
variation 2023
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:1186274818"
variation 2024
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:146797011"
variation 2026
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:1581254805"
variation 2028..2033
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="aca"
/replace="acaaca"
/db_xref="dbSNP:1454553382"
variation 2031
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1761835550"
variation 2037
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="g"
/replace="t"
/db_xref="dbSNP:930864550"
variation 2039
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1197852952"
variation 2045
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:1045385"
variation 2048
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:919528845"
variation 2049
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="g"
/replace="t"
/db_xref="dbSNP:1581254776"
variation 2050
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1471783636"
regulatory 2051..2056
/regulatory_class="polyA_signal_sequence"
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/note="hexamer: AATAAA"
variation 2054
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/db_xref="dbSNP:917285027"
variation 2056
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="t"
/db_xref="dbSNP:1250694622"
variation 2057
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:992872441"
variation 2058
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:1761834391"
variation 2064
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1761834283"
variation 2067
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1581254750"
variation 2068
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1761834114"
variation 2072
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1328185684"
variation 2073
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/db_xref="dbSNP:1761833924"
polyA_site 2076
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/note="major polyA site"
variation 2080
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:1761833789"
variation 2081
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/db_xref="dbSNP:548057203"
variation 2087
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1386591329"
variation 2091
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:1439089148"
variation 2095
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="t"
/db_xref="dbSNP:1761833492"
variation 2096
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1299579212"
variation 2097
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1287106589"
variation 2100
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1761833216"
variation 2101
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1031619666"
variation 2102
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1761833020"
variation 2104
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:770745416"
variation 2106
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="t"
/db_xref="dbSNP:1208677848"
variation 2107
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="g"
/replace="t"
/db_xref="dbSNP:749647128"
variation 2112
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:1761832619"
variation 2114
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1335396861"
variation 2117..2124
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="taa"
/replace="taaggtaa"
/db_xref="dbSNP:1761832136"
variation 2118
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:1206207432"
variation 2120
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="g"
/replace="t"
/db_xref="dbSNP:1761832325"
variation 2123
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1294989605"
variation 2124
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/db_xref="dbSNP:184322632"
variation 2128
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:529930646"
variation 2129
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1274697106"
variation 2130
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="g"
/db_xref="dbSNP:1488575938"
variation 2134
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="g"
/db_xref="dbSNP:978003444"
variation 2137
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="g"
/db_xref="dbSNP:1738244131"
variation 2137
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="g"
/replace="gg"
/db_xref="dbSNP:540540292"
variation 2141..2143
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="ttt"
/replace="tttt"
/db_xref="dbSNP:773862113"
variation 2145
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="t"
/db_xref="dbSNP:559552401"
variation 2148
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:912101100"
variation 2149
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:986171234"
variation 2154
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:953491795"
variation 2155
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1033404425"
variation 2156
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:996371955"
variation 2158
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1761830798"
variation 2160
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/db_xref="dbSNP:1000215119"
variation 2161
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:201450721"
variation 2163
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1761830322"
variation 2167
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1457572911"
variation 2170
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1761830043"
variation 2171
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1292186347"
variation 2173
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:541132655"
variation 2174
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1392537049"
variation 2175
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1761829416"
variation 2178
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1008635901"
variation 2179
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:886127182"
variation 2181
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="g"
/db_xref="dbSNP:1047402910"
variation 2182
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1761828624"
variation 2186
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="g"
/db_xref="dbSNP:576308493"
variation 2188
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:967666380"
variation 2189
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:75419063"
variation 2194..2196
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="t"
/replace="tgt"
/db_xref="dbSNP:899381145"
variation 2197
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:2113994719"
variation 2198
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1321699771"
variation 2199
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1481502601"
variation 2200..2210
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="tatttat"
/replace="tatttatttat"
/db_xref="dbSNP:1761827133"
variation 2201
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1761827592"
variation 2202
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1205517569"
variation 2209
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/db_xref="dbSNP:1761827282"
variation 2210
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="t"
/db_xref="dbSNP:1761826955"
variation 2212
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="t"
/db_xref="dbSNP:564928565"
variation 2213
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1761826632"
variation 2223
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:543460673"
variation 2224
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="g"
/db_xref="dbSNP:1190209109"
variation 2228
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="t"
/db_xref="dbSNP:1414584845"
variation 2230
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="g"
/db_xref="dbSNP:1167723607"
variation 2236
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="t"
/db_xref="dbSNP:1761825811"
variation 2237
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:1162930769"
variation 2239
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:181681871"
variation 2245
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1456044231"
variation 2247
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="g"
/db_xref="dbSNP:1761825092"
variation 2248..2251
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="ttt"
/replace="tttt"
/db_xref="dbSNP:917418676"
variation 2250
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="g"
/replace="t"
/db_xref="dbSNP:147713410"
variation 2251
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="t"
/db_xref="dbSNP:2113994544"
variation 2253
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1470971654"
variation 2254
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:1761824465"
variation 2255..2256
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="cc"
/replace="ccc"
/db_xref="dbSNP:1761824085"
variation 2255
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:201819112"
variation 2256
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1581254505"
variation 2257..2267
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="ttttttt"
/replace="tttttttt"
/replace="tttttttttt"
/replace="ttttttttttt"
/replace="tttttttttttt"
/replace="ttttttttttttt"
/replace="tttttttttttttt"
/replace="ttttttttttttttt"
/db_xref="dbSNP:rs61569279"
variation 2257
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:74636495"
variation 2261..2262
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace=""
/replace="g"
/db_xref="dbSNP:1761823491"
variation 2262
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1761823358"
variation 2264..2265
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace=""
/replace="a"
/db_xref="dbSNP:992901960"
variation 2264
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="g"
/replace="t"
/db_xref="dbSNP:1761823191"
variation 2265..2273
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="tttat"
/replace="tttatttat"
/db_xref="dbSNP:1761820963"
variation 2265
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:542820219"
variation 2267..2268
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace=""
/replace="tta"
/replace="ttta"
/db_xref="dbSNP:546035279"
variation 2267
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="t"
/db_xref="dbSNP:78186274"
variation 2268
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="aa"
/db_xref="dbSNP:1228891486"
variation 2268
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:1308848637"
variation 2269..2271
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="ttt"
/replace="tttt"
/db_xref="dbSNP:1273620078"
variation 2272
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:1212928116"
variation 2273
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="t"
/replace="tt"
/db_xref="dbSNP:1554110428"
variation 2276
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="g"
/db_xref="dbSNP:2113994377"
variation 2279
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:1554110426"
variation 2280..2296
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="tt"
/replace="ttgtttacctcttgttt"
/db_xref="dbSNP:1761816810"
variation 2281
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="g"
/replace="t"
/db_xref="dbSNP:1761820444"
variation 2282
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="g"
/replace="t"
/db_xref="dbSNP:1761820269"
variation 2285
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:572623022"
variation 2286
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:934727559"
variation 2288
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="g"
/db_xref="dbSNP:1001269086"
variation 2290
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1761819788"
variation 2291..2292
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace=""
/replace="tt"
/db_xref="dbSNP:1761819702"
variation 2293
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="g"
/db_xref="dbSNP:978704830"
variation 2294
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:967992812"
variation 2296
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:1761816701"
variation 2301
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:1275044076"
variation 2302
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="g"
/replace="t"
/db_xref="dbSNP:1206706862"
variation 2305
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1761816359"
variation 2308
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1761816249"
variation 2309
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:1581254427"
variation 2310
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="g"
/replace="t"
/db_xref="dbSNP:888219576"
variation 2311
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/db_xref="dbSNP:574855862"
variation 2314
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1761815761"
variation 2318
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:1581254407"
variation 2319..2324
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="tt"
/replace="ttagtt"
/db_xref="dbSNP:1225215874"
variation 2322
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1761815484"
variation 2337
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/db_xref="dbSNP:1761815283"
variation 2340
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:1353119982"
variation 2341
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1300520666"
variation 2346
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="g"
/db_xref="dbSNP:1581254387"
variation 2347
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1761814831"
variation 2357
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1761814733"
variation 2362
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="g"
/replace="t"
/db_xref="dbSNP:3088288"
variation 2366
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:2763171"
variation 2368
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="g"
/replace="t"
/db_xref="dbSNP:1761814367"
variation 2370
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1761814285"
variation 2371
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:770287660"
variation 2372..2378
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="tttttt"
/replace="ttttttt"
/replace="tttttttt"
/db_xref="dbSNP:768958142"
variation 2372
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="t"
/db_xref="dbSNP:1761814096"
variation 2373
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:1273247813"
variation 2378
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1440341474"
variation 2380
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="g"
/replace="t"
/db_xref="dbSNP:1362755113"
variation 2381
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1761813511"
variation 2383
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1236149981"
variation 2384
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1279251186"
variation 2386
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:929663694"
variation 2387
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1208170205"
variation 2390
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1761813026"
variation 2391
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="g"
/replace="t"
/db_xref="dbSNP:115631304"
variation 2397
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1761812813"
variation 2399
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:1036570717"
variation 2407
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1561702611"
variation 2411
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1008668333"
variation 2417..2419
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="aa"
/replace="aaa"
/db_xref="dbSNP:1761812402"
variation 2421
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:2113994056"
variation 2422
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1246352169"
variation 2424
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:944993067"
variation 2425
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="g"
/db_xref="dbSNP:1761812209"
variation 2429
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:912048188"
variation 2432
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="g"
/db_xref="dbSNP:2113994031"
variation 2434
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1761812019"
variation 2435
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1761811868"
variation 2436
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:2763170"
variation 2437
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:1761811530"
variation 2440
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1455856393"
variation 2443
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1192094582"
variation 2451
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1761811140"
variation 2454
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/db_xref="dbSNP:986284423"
variation 2455
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:113256477"
variation 2462
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:926067373"
variation 2463
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="g"
/replace="t"
/db_xref="dbSNP:1390201473"
variation 2466
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:185414193"
variation 2470
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1761810110"
variation 2471..2476
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="ta"
/replace="taatta"
/db_xref="dbSNP:1319488970"
variation 2477
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="g"
/replace="t"
/db_xref="dbSNP:898830681"
variation 2480
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:1422692618"
variation 2481
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:967404207"
variation 2482
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1454364823"
variation 2483
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1761809055"
variation 2485
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1254305813"
variation 2489
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="g"
/replace="t"
/db_xref="dbSNP:1366870946"
variation 2500
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1045079330"
variation 2505
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:558581973"
variation 2506
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:1242562543"
variation 2507
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:1014169148"
variation 2511
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1310209012"
variation 2512..2518
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="aaaaaaa"
/replace="aaaaaaaa"
/db_xref="dbSNP:1761807694"
variation 2513
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/db_xref="dbSNP:537069740"
variation 2519
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:773868091"
variation 2520
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="g"
/replace="t"
/db_xref="dbSNP:1222840005"
variation 2522
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:1458670881"
variation 2524
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:781574382"
variation 2530
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:569833793"
variation 2535
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:896012283"
variation 2537
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1761806319"
variation 2538
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1157722187"
variation 2542
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="t"
/db_xref="dbSNP:1226225494"
variation 2550
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1057206801"
variation 2552..2554
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace=""
/replace="gag"
/db_xref="dbSNP:1761804600"
variation 2552
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="g"
/db_xref="dbSNP:1761805589"
variation 2556..2557
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="gg"
/replace="ggg"
/db_xref="dbSNP:1761804416"
variation 2557
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:1406708427"
variation 2558..2560
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="tt"
/replace="ttt"
/db_xref="dbSNP:1324040714"
variation 2563..2569
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="t"
/replace="taaccct"
/db_xref="dbSNP:2113993526"
variation 2564..2565
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="aa"
/replace="aaa"
/db_xref="dbSNP:1761803667"
variation 2567
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1349074900"
variation 2568
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/db_xref="dbSNP:1289951647"
variation 2571
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:888157123"
variation 2573
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1581254199"
variation 2575
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:924658320"
variation 2579
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1433409201"
variation 2585
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1761802296"
variation 2587
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="g"
/replace="gg"
/db_xref="dbSNP:2113993471"
variation 2588..2597
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="aaaaaaa"
/replace="aaaaaaaaa"
/replace="aaaaaaaaaa"
/replace="aaaaaaaaaaa"
/db_xref="dbSNP:947408228"
variation 2588
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1026734969"
variation 2593
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/db_xref="dbSNP:755049370"
variation 2597..2598
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace=""
/replace="t"
/db_xref="dbSNP:1554110387"
variation 2597
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="t"
/db_xref="dbSNP:1311943316"
variation 2598
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace=""
/replace="g"
/db_xref="dbSNP:1761801065"
variation 2599..2601
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="ttt"
/replace="tttt"
/db_xref="dbSNP:1761800690"
variation 2599
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="g"
/replace="t"
/db_xref="dbSNP:2857059"
variation 2601
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:2857060"
variation 2603
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="g"
/replace="t"
/db_xref="dbSNP:1450253873"
variation 2606
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="g"
/replace="t"
/db_xref="dbSNP:1761800222"
variation 2610
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/db_xref="dbSNP:1206983895"
variation 2613
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:1434969502"
variation 2618
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:921261649"
variation 2620..2622
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="cc"
/replace="ccc"
/db_xref="dbSNP:1761799297"
variation 2620
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:11553434"
variation 2622
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1482987555"
variation 2626
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1761798951"
variation 2628
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:1761798771"
variation 2629
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="g"
/db_xref="dbSNP:2113993278"
variation 2630
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:747101844"
variation 2631
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/db_xref="dbSNP:1166174221"
variation 2639
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/db_xref="dbSNP:545023610"
variation 2651
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:2113993234"
variation 2659
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:994362396"
variation 2666
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="g"
/db_xref="dbSNP:1761798151"
variation 2669
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="g"
/replace="t"
/db_xref="dbSNP:1163493464"
variation 2670
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:80094467"
variation 2677
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:1761797693"
variation 2679
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:780237615"
variation 2680..2683
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="ttt"
/replace="tttt"
/db_xref="dbSNP:1420215580"
variation 2684
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1699367600"
variation 2685..2701
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="ctctctctctc"
/replace="ctctctctctctc"
/replace="ctctctctctctctc"
/replace="ctctctctctctctctc"
/replace="ctctctctctctctctctc"
/replace="ctctctctctctctctctctc"
/db_xref="dbSNP:rs150236619"
variation 2685
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:193259940"
variation 2690
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1409106470"
variation 2692
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1306333817"
variation 2695
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1761796981"
variation 2697
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:1761796844"
variation 2699
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1561702351"
variation 2700
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1761796606"
variation 2702..2709
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="ctctct"
/replace="ctctctct"
/db_xref="dbSNP:1026110190"
variation 2704
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1761796204"
variation 2707..2713
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="tct"
/replace="tctttct"
/db_xref="dbSNP:1275758017"
variation 2710
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1231102724"
variation 2722
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1342156023"
variation 2727
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/db_xref="dbSNP:1581254090"
variation 2729
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:994590730"
variation 2731
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:1482178043"
variation 2738
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:2763169"
variation 2739
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="t"
/db_xref="dbSNP:1761795159"
variation 2740
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:1443644771"
variation 2741
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:758681260"
variation 2745
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1761794773"
variation 2747
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="g"
/replace="t"
/db_xref="dbSNP:1761794670"
variation 2748
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1236552659"
variation 2750..2751
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="t"
/replace="tt"
/db_xref="dbSNP:1761794424"
variation 2754
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1761794313"
variation 2756
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1471590963"
variation 2760
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1190322421"
variation 2763
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/db_xref="dbSNP:1390560124"
variation 2766
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:2049737582"
variation 2770
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1761793906"
variation 2773
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:963406342"
variation 2784
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="g"
/db_xref="dbSNP:1211276559"
variation 2793
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1761793566"
variation 2803
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="t"
/db_xref="dbSNP:1404183446"
variation 2805
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="g"
/replace="t"
/db_xref="dbSNP:2113992761"
variation 2807
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1415141620"
variation 2810
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1761793114"
variation 2811
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="g"
/replace="t"
/db_xref="dbSNP:1761793009"
variation 2812
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:753621983"
variation 2813..2818
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="agt"
/replace="agtagt"
/db_xref="dbSNP:769945457"
variation 2814
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="g"
/db_xref="dbSNP:1338976093"
variation 2817
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1437540491"
variation 2821
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:890721929"
variation 2823
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1013604340"
variation 2825
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="g"
/replace="t"
/db_xref="dbSNP:186469860"
variation 2827
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/db_xref="dbSNP:1258318039"
variation 2830
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="g"
/replace="t"
/db_xref="dbSNP:1561702227"
variation 2835
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1761791966"
variation 2840
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1761791868"
variation 2843
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1346264670"
variation 2845
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="g"
/db_xref="dbSNP:1761791644"
variation 2847
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="t"
/db_xref="dbSNP:1057238457"
variation 2850
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="g"
/replace="t"
/db_xref="dbSNP:1761791415"
variation 2854..2856
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="cc"
/replace="ccc"
/db_xref="dbSNP:1277251337"
variation 2858
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:573067252"
variation 2859..2869
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="ataaata"
/replace="ataaataaata"
/db_xref="dbSNP:1248200556"
regulatory 2862..2867
/regulatory_class="polyA_signal_sequence"
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/note="hexamer: AATAAA"
variation 2863
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:903352914"
variation 2865
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1761790970"
variation 2877
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:1043562443"
variation 2878
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:926153731"
polyA_site 2883
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/note="major polyA site"
variation 2883
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="t"
/db_xref="dbSNP:978864068"
variation 2886
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:1478303478"
variation 2887
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:2113992477"
variation 2888
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1172132887"
variation 2889
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:946154698"
variation 2890..2898
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="tttttttt"
/replace="ttttttttt"
/replace="tttttttttt"
/db_xref="dbSNP:79168174"
variation 2891..2892
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace=""
/replace="g"
/db_xref="dbSNP:1321473588"
variation 2892
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="g"
/replace="t"
/db_xref="dbSNP:1458833747"
variation 2894
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="g"
/replace="t"
/db_xref="dbSNP:1761789201"
variation 2898
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="t"
/db_xref="dbSNP:1388127884"
variation 2899
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="aa"
/db_xref="dbSNP:1761788766"
variation 2899
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="t"
/db_xref="dbSNP:1761788657"
variation 2906
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="g"
/replace="t"
/db_xref="dbSNP:913219402"
variation 2913..2915
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="ttt"
/replace="ttttt"
/db_xref="dbSNP:1761788543"
variation 2916..2918
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace=""
/replace="acc"
/db_xref="dbSNP:1761788244"
variation 2916
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="t"
/db_xref="dbSNP:1233159809"
variation 2917..2919
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="cc"
/replace="ccc"
/db_xref="dbSNP:1320822161"
variation 2917
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1273796099"
variation 2920
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/db_xref="dbSNP:1761788039"
variation 2922
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="g"
/db_xref="dbSNP:763807060"
variation 2924
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:992848628"
variation 2925
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:1415705332"
variation 2926
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/db_xref="dbSNP:1761787571"
variation 2927
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="g"
/replace="t"
/db_xref="dbSNP:959914489"
variation 2928
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="t"
/db_xref="dbSNP:2113992285"
variation 2931
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1376905434"
variation 2938
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="g"
/replace="t"
/db_xref="dbSNP:1761787248"
variation 2946
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="g"
/replace="t"
/db_xref="dbSNP:1034274256"
variation 2952
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="t"
/db_xref="dbSNP:1581253902"
variation 2961
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="g"
/replace="t"
/db_xref="dbSNP:1305786147"
variation 2966
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/db_xref="dbSNP:1269166396"
variation 2967
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:979890870"
variation 2971
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:952570651"
variation 2978
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:911771746"
variation 2980
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="t"
/db_xref="dbSNP:987384905"
variation 2986
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1375793545"
variation 2987
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1473630522"
variation 2997
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace=""
/replace="g"
/db_xref="dbSNP:1761786112"
variation 3000
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1461108659"
variation 3001
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="g"
/db_xref="dbSNP:1354584022"
variation 3004
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:1027267354"
variation 3007
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:745977233"
variation 3016..3017
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="tg"
/replace="tgtg"
/db_xref="dbSNP:1761785424"
variation 3017
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="g"
/db_xref="dbSNP:1761785331"
variation 3018
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="t"
/db_xref="dbSNP:1295719804"
variation 3020..3022
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="ccc"
/db_xref="dbSNP:1761785097"
variation 3030
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:1391894372"
variation 3031
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:919086036"
variation 3032
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="g"
/db_xref="dbSNP:896920283"
variation 3034
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:2763168"
variation 3039
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1007857899"
regulatory 3041..3046
/regulatory_class="polyA_signal_sequence"
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/note="hexamer: AATAAA"
variation 3044
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1761784435"
variation 3050..3051
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="t"
/replace="tt"
/replace="ttt"
/db_xref="dbSNP:1761784308"
variation 3051
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1229723381"
variation 3054
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="g"
/replace="t"
/db_xref="dbSNP:752628820"
variation 3061
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1288405877"
variation 3064
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="g"
/replace="t"
/db_xref="dbSNP:1761783880"
polyA_site 3065
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
variation 3065
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/db_xref="dbSNP:1761783761"
variation 3067
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:890669566"
variation 3070
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1050634350"
variation 3075
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1761783433"
variation 3078
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="g"
/replace="t"
/db_xref="dbSNP:1236415373"
variation 3079..3081
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="tat"
/replace="tatat"
/db_xref="dbSNP:1188398798"
variation 3082
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:1266786003"
variation 3083
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1476033051"
variation 3097
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1356790715"
variation 3099
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:552923535"
variation 3102
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1761782572"
variation 3107
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1266707717"
variation 3110
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1761782391"
variation 3111
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:904677951"
variation 3112
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:963137415"
variation 3119
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:1183030841"
variation 3124..3125
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace=""
/replace="aa"
/db_xref="dbSNP:2113991630"
variation 3129
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1761781954"
variation 3131
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:2113991609"
variation 3135
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:16893358"
variation 3143..3146
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="ttt"
/replace="tttt"
/db_xref="dbSNP:1417621210"
variation 3149
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:991137970"
variation 3151
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1761781395"
variation 3156
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:2113991509"
variation 3157..3164
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="ttgt"
/replace="ttgtttgt"
/db_xref="dbSNP:372257234"
variation 3157..3158
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="tt"
/replace="ttt"
/db_xref="dbSNP:1581253754"
variation 3158
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1251986694"
variation 3162
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="g"
/replace="t"
/db_xref="dbSNP:1369206619"
variation 3163
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:946130784"
variation 3167
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="t"
/db_xref="dbSNP:1373001091"
variation 3171
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1410944291"
variation 3172
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/db_xref="dbSNP:1581253719"
variation 3174
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1308181918"
variation 3176
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1761780279"
variation 3179
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1761780173"
variation 3181
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1761780065"
variation 3189
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:2113991315"
variation 3193
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1761779973"
variation 3196
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="g"
/replace="t"
/db_xref="dbSNP:1333337314"
variation 3199
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="g"
/db_xref="dbSNP:1389109049"
variation 3203
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1035936230"
variation 3205
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1761779529"
variation 3217
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="g"
/replace="t"
/db_xref="dbSNP:1761779429"
variation 3218
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="t"
/db_xref="dbSNP:1321895923"
variation 3220
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="g"
/replace="t"
/db_xref="dbSNP:1761779241"
regulatory 3225..3230
/regulatory_class="polyA_signal_sequence"
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/note="hexamer: AATAAA"
variation 3227
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1761779129"
variation 3236
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:1761779034"
variation 3242
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1243853812"
variation 3243
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="c"
/replace="t"
/db_xref="dbSNP:1289281376"
variation 3247
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="g"
/db_xref="dbSNP:913330699"
polyA_site 3251
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
variation 3251
/gene="TFAP2A"
/gene_synonym="AP-2; AP-2alpha; AP2TF; BOFS; TFAP2"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:1234343067"
ORIGIN
gtgcggcgctgggactgcagctggcggagtgaattcctgggccagcgcgcatgcgtcggcaggtagcaacccagctctttatgaccaggtgagatgttggtgagcaggtaaaaaaggaggatttgcctaagcgattccagggagctggcccgaccgagccctccagcccatgcccggcggggaccagtcgccaggagcgcagagccgcgatgtccatacttgccaaaatgggggactggcaggaccgtcacgacggcaccagcaacgggacggcacggttgccccagctgggcactgtaggtcaatctccctacacgagcgccccgccgctgtcccacacccccaatgccgacttccagcccccatacttccccccaccctaccagcctatctacccccagtcgcaagatccttactcccacgtcaacgacccctacagcctgaaccccctgcacgcccagccgcagccgcagcacccaggctggcccggccagaggcagagccaggagtctgggctcctgcacacgcaccgggggctgcctcaccagctgtcgggcctggatcctcgcagggactacaggcggcacgaggacctcctgcacggcccacacgcgctcagctcaggactcggagacctctcgatccactccttacctcacgccatcgaggaggtcccgcatgtagaagacccgggtattaacatcccagatcaaactgtaattaagaaaggccccgtgtccctgtccaagtccaacagcaatgccgtctccgccatccctattaacaaggacaacctcttcggcggcgtggtgaaccccaacgaagtcttctgttcagttccgggtcgcctctcgctcctcagctccacctcgaagtacaaggtcacggtggcggaagtgcagcggcggctctcaccacccgagtgtctcaacgcgtcgctgctgggcggagtgctccggagggcgaagtctaaaaatggaggaagatctttaagagaaaaactggacaaaataggattaaatctgcctgcagggagacgtaaagctgccaacgttaccctgctcacatcactagtagagggagaagctgtccacctagccagggactttgggtacgtgtgcgaaaccgaatttcctgccaaagcagtagctgaatttctcaaccgacaacattccgatcccaatgagcaagtgacaagaaaaaacatgctcctggctacaaaacagatatgcaaagagttcaccgacctgctggctcaggaccgatctcccctggggaactcacggcccaaccccatcctggagcccggcatccagagctgcttgacccacttcaacctcatctcccacggcttcggcagccccgcggtgtgtgccgcggtcacggccctgcagaactatctcaccgaggccctcaaggccatggacaaaatgtacctcagcaacaaccccaacagccacacggacaacaacgccaaaagcagtgacaaagaggagaagcacagaaagtgaggctctcctcccgccccgcccctcccacgcctcaccagccccccgcgcgcccaccctccggcgggtgacagctccgggatcagcaacccttcctgctgctgctactgctgctgctgctgccgccgccgccgccgccgctgcccttgggtccccccgagtctccgggactgccctctcgactgtcagtggggcagcctctccgactctgcacccgcctcgacctccccacccgctcccacacccctgtgccctcatgtggagcctaagagaacagaacaggccgtgaagccagcagagaaaagttctgccaagtttgtgaacccttttttttttaaacaaaacaacaaatcaacaacagcaacaacaacaacaaaaattaaaaacttttttctaaaaaaaaagtgaaaataaaaaaaattatatgcgcttcatgggactgagtcaccaccttcccttacatacttcagttcagattgtagccatacttaaaaaaaaaaaaaaagccaaaagatgatgacaacatttttatcagtattgtgaataaacttgaacacaaatacacgaagttccatgtcatgtcttcagttgtagaagtttttcctctttaaggtaaagcgaccaacttgaactttctctggcaacacgattcgcagttatataagggaatcagtgttcacgtctctgtatatatttatttatgtgtaatttaatgggaattgtaaatatggtgagtctgttttaagcctttttttttttatttatctgatcttgtttacctcttgtttagtgggttttgaatcttccctattagttcttcatgtggttcatggtactgatttagaaatccagtgtttgggggatttttttctctgggattcatgaatttagccctgttgtagcatgttaaaggtgacaaacagctggacaaatttttaaaaagtaaaataaaattttatctataattagtattattacatttagcttttcattgaaccgaaagaaaaaaagtgatattggaccctggaaagattttgaaacttgagtggtttgataacccttctatgtattgtagggagaaaaaaaaaagtttattttattccactgtcctcccttaaaagcatcatttgagcaataaatgaatattgtctttaaaccaagggttagggaattttcctctctctctctctctcctctctctttctgttcaaagaacttcaaacatttgggaccacctggtattctgtattttcactggccatattggaagcagttctagttgcattgtattgagttgtgctggcagtagtttccatgcctgtcaatgtatcatagtcctttgttgcccagataaataaatatttgatacgctttatgtcgatttttttttattcagtggctgtctttacccaggcgtatttttgttcttggcagtattttttattcagtatggttacagtaattgagtttaactctcccttggcaattgctccttgcaataagcagctgaacccattgtttccctcaagtataataaaaacttactttcaacttggagttcagagcagggtatcatttagatattccactgtgtctgtattcagacaaatgacacaataaaacccaatgtattcttttggataaaagattgtttgtactgctaaaggaatgacatactgtcttttccttactagaaacattaattttattattaaaaataaagttttattttatttatgttga
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]