GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-08 05:11:57, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       NM_000100                588 bp    mRNA    linear   PRI 18-NOV-2023
DEFINITION  Homo sapiens cystatin B (CSTB), mRNA.
ACCESSION   NM_000100
VERSION     NM_000100.4
KEYWORDS    RefSeq; MANE Select.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 588)
  AUTHORS   Opsteen S, Moylan D, Taiwo BO, Robertson KR, Overton ET, Cutter GR,
            Sabbaj S, Heath SL and Shacka JJ.
  TITLE     Brief Report: Intracellular Cystatin B Levels Are Altered in
            HIV-Infected Participants With Respect to Neurocognitive Status and
            Antiretroviral Therapy
  JOURNAL   J Acquir Immune Defic Syndr 91 (5), 485-489 (2022)
   PUBMED   36083516
  REMARK    GeneRIF: Brief Report: Intracellular Cystatin B Levels Are Altered
            in HIV-Infected Participants With Respect to Neurocognitive Status
            and Antiretroviral Therapy.
REFERENCE   2  (bases 1 to 588)
  AUTHORS   Borges-Velez G, Arroyo JA, Cantres-Rosario YM, Rodriguez de Jesus
            A, Roche-Lima A, Rosado-Philippi J, Rosario-Rodriguez LJ,
            Correa-Rivas MS, Campos-Rivera M and Melendez LM.
  TITLE     Decreased CSTB, RAGE, and Axl Receptor Are Associated with Zika
            Infection in the Human Placenta
  JOURNAL   Cells 11 (22), 3627 (2022)
   PUBMED   36429055
  REMARK    GeneRIF: Decreased CSTB, RAGE, and Axl Receptor Are Associated with
            Zika Infection in the Human Placenta.
            Publication Status: Online-Only
REFERENCE   3  (bases 1 to 588)
  AUTHORS   Huang C, Ai X, Hu L and Ren D.
  TITLE     The Role of NMP22 and CSTB Levels in Predicting Postoperative
            Recurrence of Bladder Cancer
  JOURNAL   J Immunol Res 2022, 6735310 (2022)
   PUBMED   35647202
  REMARK    GeneRIF: The Role of NMP22 and CSTB Levels in Predicting
            Postoperative Recurrence of Bladder Cancer.
            Publication Status: Online-Only
REFERENCE   4  (bases 1 to 588)
  AUTHORS   Koopaie M, Ghafourian M, Manifar S, Younespour S, Davoudi M,
            Kolahdooz S and Shirkhoda M.
  TITLE     Evaluation of CSTB and DMBT1 expression in saliva of gastric cancer
            patients and controls
  JOURNAL   BMC Cancer 22 (1), 473 (2022)
   PUBMED   35488257
  REMARK    GeneRIF: Evaluation of CSTB and DMBT1 expression in saliva of
            gastric cancer patients and controls.
            Publication Status: Online-Only
REFERENCE   5  (bases 1 to 588)
  AUTHORS   Bosak M, Sulek A, Lukasik M, Zak A, Slowik A and Lasek-Bal A.
  TITLE     Genetic testing and the phenotype of Polish patients with
            Unverricht-Lundborg disease (EPM1) - A cohort study
  JOURNAL   Epilepsy Behav 112, 107439 (2020)
   PUBMED   32920378
  REMARK    GeneRIF: Genetic testing and the phenotype of Polish patients with
            Unverricht-Lundborg disease (EPM1) - A cohort study.
REFERENCE   6  (bases 1 to 588)
  AUTHORS   Lehesjoki,A.E. and Kalviainen,R.
  TITLE     Progressive Myoclonic Epilepsy Type 1
  JOURNAL   (in) Adam MP, Feldman J, Mirzaa GM, Pagon RA, Wallace SE, Bean LJH,
            Gripp KW and Amemiya A (Eds.);
            GENEREVIEWS(R);
            (1993)
   PUBMED   20301321
REFERENCE   7  (bases 1 to 588)
  AUTHORS   Turk V and Bode W.
  TITLE     The cystatins: protein inhibitors of cysteine proteinases
  JOURNAL   FEBS Lett 285 (2), 213-219 (1991)
   PUBMED   1855589
  REMARK    Review article
REFERENCE   8  (bases 1 to 588)
  AUTHORS   Stubbs MT, Laber B, Bode W, Huber R, Jerala R, Lenarcic B and Turk
            V.
  TITLE     The refined 2.4 A X-ray crystal structure of recombinant human
            stefin B in complex with the cysteine proteinase papain: a novel
            type of proteinase inhibitor interaction
  JOURNAL   EMBO J 9 (6), 1939-1947 (1990)
   PUBMED   2347312
REFERENCE   9  (bases 1 to 588)
  AUTHORS   Jerala R, Trstenjak M, Lenarcic B and Turk V.
  TITLE     Cloning a synthetic gene for human stefin B and its expression in
            E. coli
  JOURNAL   FEBS Lett 239 (1), 41-44 (1988)
   PUBMED   3053245
REFERENCE   10 (bases 1 to 588)
  AUTHORS   Jarvinen M, Rinne A and Hopsu-Havu VK.
  TITLE     Human cystatins in normal and diseased tissues--a review
  JOURNAL   Acta Histochem 82 (1), 5-18 (1987)
   PUBMED   3122506
  REMARK    Review article
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from BC003370.1.
            
            On Nov 21, 2019 this sequence version replaced NM_000100.3.
            
            Summary: The cystatin superfamily encompasses proteins that contain
            multiple cystatin-like sequences. Some of the members are active
            cysteine protease inhibitors, while others have lost or perhaps
            never acquired this inhibitory activity. There are three inhibitory
            families in the superfamily, including the type 1 cystatins
            (stefins), type 2 cystatins and kininogens. This gene encodes a
            stefin that functions as an intracellular thiol protease inhibitor.
            The protein is able to form a dimer stabilized by noncovalent
            forces, inhibiting papain and cathepsins l, h and b. The protein is
            thought to play a role in protecting against the proteases leaking
            from lysosomes. Evidence indicates that mutations in this gene are
            responsible for the primary defects in patients with progressive
            myoclonic epilepsy (EPM1). One type of mutation responsible for
            EPM1 is the expansion in the promoter region of this gene of a
            CCCCGCCCCGCG repeat from 2-3 copies to 30-78 copies. [provided by
            RefSeq, Jul 2016].
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BE794956.1, BQ691925.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA1965299, SAMEA1966682
                                           [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            MANE Ensembl match     :: ENST00000291568.7/ ENSP00000291568.6
            RefSeq Select criteria :: based on single protein-coding transcript
            ##RefSeq-Attributes-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-588               BC003370.1         6-593
FEATURES             Location/Qualifiers
     source          1..588
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="21"
                     /map="21q22.3"
     gene            1..588
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /note="cystatin B"
                     /db_xref="GeneID:1476"
                     /db_xref="HGNC:HGNC:2482"
                     /db_xref="MIM:601145"
     exon            1..105
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /inference="alignment:Splign:2.1.0"
     variation       2
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1356507368"
     variation       3
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:898940441"
     variation       4
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1185421595"
     variation       5
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:2084010296"
     variation       6
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1398406036"
     variation       7
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:770366711"
     variation       8
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1319227973"
     variation       9
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1016407391"
     variation       10
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1388604204"
     variation       13
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:759773569"
     variation       14
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1461860051"
     variation       15
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2084010161"
     variation       16
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:897793602"
     variation       17
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1012720999"
     variation       18
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1168338515"
     variation       22
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1313212349"
     variation       23
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2084009972"
     variation       24
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1477355983"
     variation       27
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:770995817"
     variation       28
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:779920568"
     variation       33
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2084009902"
     variation       34
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1449391245"
     variation       36
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1265973427"
     variation       38
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2123387973"
     CDS             40..336
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /note="liver thiol proteinase inhibitor; cystatin B
                     (stefin B); epididymis secretory sperm binding protein"
                     /codon_start=1
                     /product="cystatin-B"
                     /protein_id="NP_000091.1"
                     /db_xref="CCDS:CCDS13701.1"
                     /db_xref="GeneID:1476"
                     /db_xref="HGNC:HGNC:2482"
                     /db_xref="MIM:601145"
                     /translation="
MMCGAPSATQPATAETQHIADQVRSQLEEKENKKFPVFKAVSFKSQVVAGTNYFIKVHVGDEDFVHLRVFQSLPHENKPLTLSNYQTNKAKHDELTYF"
     misc_feature    40..42
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /note="N-acetylmethionine.
                     /evidence=ECO:0007744|PubMed:19413330,
                     ECO:0007744|PubMed:22223895; propagated from
                     UniProtKB/Swiss-Prot (P04080.2); acetylation site"
     misc_feature    49..315
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /note="Cystatin domain; Region: Cystatin; pfam00031"
                     /db_xref="CDD:425431"
     misc_feature    order(49..51,175..183,187..189)
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /note="putative proteinase inhibition site [active]"
                     /db_xref="CDD:238002"
     misc_feature    49..51
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /note="Reactive site; propagated from UniProtKB/Swiss-Prot
                     (P04080.2); other site"
     misc_feature    175..189
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /note="propagated from UniProtKB/Swiss-Prot (P04080.2);
                     Region: Secondary area of contact"
     variation       40..41
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace=""
                     /replace="at"
                     /db_xref="dbSNP:1044894207"
     variation       41
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:777803544"
     variation       42
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1208657701"
     variation       46
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:938561596"
     variation       47
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1336036139"
     variation       48
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:555930471"
     variation       49..52
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="ggg"
                     /replace="gggg"
                     /db_xref="dbSNP:1555888493"
     variation       49
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:74315443"
     variation       51
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1555888494"
     variation       54
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:4533"
     variation       55
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1236504207"
     variation       56
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1271010543"
     variation       57
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1433080469"
     variation       58
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1470347103"
     variation       59
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:2084009632"
     variation       60
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:748254497"
     variation       62
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1322920024"
     variation       65
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:778785343"
     variation       66
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:945357152"
     variation       67
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1399970116"
     variation       68
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:569851503"
     variation       69
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:9984466"
     variation       70
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2084009509"
     variation       71
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1168439504"
     variation       72
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2123387882"
     variation       73
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1334834868"
     variation       74
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1464958440"
     variation       75
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2123387876"
     variation       78
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1419893626"
     variation       79
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1169287716"
     variation       80
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1340088200"
     variation       81
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:2123387857"
     variation       82
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:11553836"
     variation       83
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:2084009402"
     variation       84
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1057521317"
     variation       86
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2084009370"
     variation       93
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:557717323"
     variation       94
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1349028244"
     variation       96
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2084009328"
     variation       101
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1400814522"
     variation       102
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1228269783"
     variation       103
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1569006250"
     variation       105
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:386833443"
     exon            106..207
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /inference="alignment:Splign:2.1.0"
     variation       111
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1281177958"
     variation       112
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:772315538"
     variation       122
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2084002212"
     variation       124
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1358304104"
     variation       127..129
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="a"
                     /replace="aaa"
                     /db_xref="dbSNP:762632973"
     variation       130
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1313119823"
     variation       133..137
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="aa"
                     /replace="aacaa"
                     /db_xref="dbSNP:750620672"
     variation       135
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1436155713"
     variation       138
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:2084002133"
     variation       139
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2084002121"
     variation       141
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace=""
                     /replace="g"
                     /db_xref="dbSNP:2084002108"
     variation       145
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:748162136"
     variation       146
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1045956757"
     variation       149
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:2084002061"
     variation       150
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:774504790"
     variation       151
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1295324725"
     variation       152
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1365612504"
     variation       154
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1601856130"
     variation       157
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:760102906"
     variation       158
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1409443033"
     variation       159
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:368198839"
     variation       160
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace=""
                     /replace="g"
                     /db_xref="dbSNP:1257171692"
     variation       160
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:143153487"
     variation       164
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:386833439"
     variation       168
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:2084001866"
     variation       169
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:2084001847"
     variation       173
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1569005696"
     variation       174
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:375008755"
     variation       175
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:545986367"
     variation       176
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:745678958"
     variation       178
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:140799752"
     variation       179
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:2084001744"
     variation       183
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:202096395"
     variation       184
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:559906825"
     variation       185
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:754421704"
     variation       186
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:766654703"
     variation       188
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:312262708"
     variation       189
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:372787200"
     variation       194
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:541671661"
     variation       196
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200236513"
     variation       197
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:762082236"
     variation       199
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:774291632"
     variation       200..205
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="tca"
                     /replace="tcatca"
                     /db_xref="dbSNP:1447346452"
     variation       201
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2123386036"
     variation       206
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:935774172"
     variation       207
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:386833440"
     exon            208..588
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /inference="alignment:Splign:2.1.0"
     variation       208
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:796052394"
     variation       210
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:778853977"
     variation       211
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2083999686"
     variation       213
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:763095750"
     variation       214
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:531685360"
     variation       216
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:765477010"
     variation       217..218
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="gg"
                     /replace="ggg"
                     /db_xref="dbSNP:2123385588"
     variation       217
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:759511758"
     variation       218
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:776753992"
     variation       219
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:771027631"
     variation       220
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:199549401"
     variation       222
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:772899788"
     variation       223
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:147307021"
     variation       226
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:747824864"
     variation       228
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:2123385558"
     variation       229
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1453887819"
     variation       230
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1569005540"
     variation       231
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:773820884"
     variation       232
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:570768038"
     variation       235
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:748818442"
     variation       238
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:2083999421"
     variation       239..242
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="tgcg"
                     /replace="tgcgtgcg"
                     /db_xref="dbSNP:1601855887"
     variation       240
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1249703879"
     variation       241
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:74315442"
     variation       242
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:757707761"
     variation       247
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:200577790"
     variation       249
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1569005524"
     variation       250
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:778054354"
     variation       251
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:121909346"
     variation       252
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:758639236"
     variation       253..258
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="tctc"
                     /replace="tctctc"
                     /db_xref="dbSNP:796943858"
     variation       253
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:796052392"
     variation       257
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="t"
                     /replace="tt"
                     /db_xref="dbSNP:1491180684"
     variation       259
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2083999223"
     variation       260
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:753004113"
     variation       262
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:765382240"
     variation       263
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:755073483"
     variation       264
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:753974589"
     variation       269
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1436835041"
     variation       271
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:2083999131"
     variation       274
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:766285245"
     variation       277
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:935631294"
     variation       279
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:2083999089"
     variation       282
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2083999070"
     variation       284..286
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="t"
                     /replace="tat"
                     /db_xref="dbSNP:763450239"
     variation       285
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2123385440"
     variation       287..293
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="cta"
                     /replace="ctaacta"
                     /db_xref="dbSNP:1555888363"
     variation       287
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:2083999036"
     variation       289
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:760590053"
     variation       292
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1285879003"
     variation       295
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1354234316"
     variation       299
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:952031050"
     variation       301
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:138149594"
     variation       303
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:767258722"
     variation       304
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1211836265"
     variation       306
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2083998905"
     variation       307
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:761504637"
     variation       308
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:138337167"
     variation       312
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:540215875"
     variation       313
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:796052393"
     variation       325
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:773945210"
     variation       329
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1186810947"
     variation       331
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:2123385384"
     variation       333
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2123385381"
     variation       334
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2083998796"
     variation       335
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1485823721"
     variation       336
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:768327092"
     variation       340
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2123385371"
     variation       341
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1213909681"
     variation       342
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2083998715"
     variation       343
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:201576714"
     variation       344
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:771454244"
     variation       350
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:747533289"
     variation       354
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1319141411"
     variation       355
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:6384"
     variation       359
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2083998608"
     variation       363
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:758734018"
     variation       364
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1356378444"
     variation       366
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:971973529"
     variation       369
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:987489415"
     variation       372
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:748541590"
     variation       377
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:955665304"
     variation       381
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1803345"
     variation       386
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:779214107"
     variation       388
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1024515544"
     variation       389
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1028951395"
     variation       392
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1270718055"
     variation       398
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:996856330"
     variation       399
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2083998435"
     variation       400
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:147403584"
     variation       401
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:962693113"
     variation       405
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:142767585"
     variation       409
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2083998372"
     variation       410
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:6385"
     variation       411
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:886969324"
     variation       415
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1033243957"
     variation       416
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1292699753"
     variation       421
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2083998291"
     variation       425
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1437602567"
     variation       426
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:2083998261"
     variation       428
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2083998240"
     variation       429
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:9446"
     variation       430
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2123385245"
     variation       431
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1336506986"
     variation       434
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:776058497"
     variation       435
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1361407776"
     variation       437
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1201328934"
     variation       438
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:2083998090"
     variation       439
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1028085696"
     variation       440
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:2083998075"
     variation       443
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2083998064"
     variation       444
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2083998052"
     variation       445
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2083998044"
     variation       455
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1258704280"
     variation       458
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:554605638"
     variation       460
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2083997995"
     variation       463
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2123385199"
     variation       465
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1484953182"
     variation       473
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:2123385192"
     variation       474
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:13765"
     variation       493
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1569005420"
     variation       498
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2083997950"
     variation       499
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1168878991"
     variation       503
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2083997921"
     variation       505
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2083997901"
     variation       509
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:576730070"
     variation       517
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:558255323"
     variation       519
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2083997865"
     variation       521
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2083997856"
     variation       525
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1187891183"
     variation       528
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:11553835"
     variation       529
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1409880683"
     variation       530
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2083997810"
     variation       532
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:540274837"
     variation       533
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1752862022"
     variation       536
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2083997772"
     variation       537
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:572952209"
     variation       538
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:900917625"
     variation       539..545
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="tta"
                     /replace="ttaatta"
                     /db_xref="dbSNP:1174072070"
     variation       542
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:554739469"
     variation       543
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1362800347"
     variation       545
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1466237377"
     variation       549
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1036902560"
     variation       557
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1442448154"
     variation       563
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:886057112"
     regulatory      564..569
                     /regulatory_class="polyA_signal_sequence"
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /note="hexamer: AATAGA"
     variation       568
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1413995537"
     variation       569
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:536022878"
     variation       570
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1242098640"
     variation       571
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="a"
                     /replace="aa"
                     /db_xref="dbSNP:2083997626"
     variation       571
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2083997615"
     variation       572
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:935703178"
     variation       573
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1304969375"
     variation       575
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:925620723"
     variation       578
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:2083997562"
     variation       579
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:568581184"
     variation       586
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1041474318"
     polyA_site      588
                     /gene="CSTB"
                     /gene_synonym="CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD"
                     /note="major polyA site"
ORIGIN      
gccgagtcccctcgccagattccctccgtcgccgccaagatgatgtgcggggcgccctccgccacgcagccggccaccgccgagacccagcacatcgccgaccaggtgaggtcccagcttgaagagaaagaaaacaagaagttccctgtgtttaaggccgtgtcattcaagagccaggtggtcgcggggacaaactacttcatcaaggtgcacgtcggcgacgaggacttcgtacacctgcgagtgttccaatctctccctcatgaaaacaagcccttgaccttatctaactaccagaccaacaaagccaagcatgatgagctgacctatttctgatcctgactttggacaaggcccttcagccagaagactgacaaagtcatcctccgtctaccagagcgtgcacttgtgatcctaaaataagcttcatctccgggctgtgccccttggggtggaaggggcaggattctgcagctgcttttgcatttctcttcctaaatttcattgtgttgatttctttccttcccaataggtgatcttaattactttcagaatattttcaaaatagatatatttttaaaatcctta
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]