2024-05-20 08:58:30, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_040670353 1642 bp mRNA linear VRT 01-MAR-2022 DEFINITION PREDICTED: Gallus gallus ring finger protein 24 (RNF24), transcript variant X4, mRNA. ACCESSION XM_040670353 VERSION XM_040670353.2 DBLINK BioProject: PRJNA698614 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; Phasianidae; Phasianinae; Gallus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_052576.1) annotated using gene prediction method: Gnomon, supported by mRNA evidence. Also see: Documentation of NCBI's Annotation Process On Mar 1, 2022 this sequence version replaced XM_040670353.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Gallus gallus Annotation Release 106 Annotation Version :: 106 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 9.0 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1642 /organism="Gallus gallus" /mol_type="mRNA" /isolate="bGalGal1" /db_xref="taxon:9031" /chromosome="4" /sex="female" /tissue_type="blood" /country="USA: Fayetteville" /lat_lon="36.0822 N 94.1719 W" /collection_date="20-May-2019" /collected_by="Nick Anthony" gene 1..1642 /gene="RNF24" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 mRNAs, 222 long SRA reads, 6 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 82 samples with support for all annotated introns" /db_xref="CGNC:65426" /db_xref="GeneID:100857605" misc_feature 1 /gene="RNF24" /experiment="COORDINATES: cap analysis [ECO:0007248]" /note="transcription start site" CDS 40..486 /gene="RNF24" /codon_start=1 /product="RING finger protein 24 isoform X4" /protein_id="XP_040526287.1" /db_xref="GeneID:100857605" /db_xref="CGNC:65426" /translation="
MSSDFQHYSFRMPNIGFQNLPLNIYIVVFGTAIFVFILSLLFCCYLIRLRHQAHKELYAYKQVILKEKVKELNLHEICAVCLEEFKPKDELGICPCKHAFHRKCLIKWLEVRKVCPLCNMPVLQLAQLHSKQDPGPPQGPLPGAENIV"
misc_feature 265..423 /gene="RNF24" /note="RING finger, H2 subclass, found in RING finger protein 24 (RNF24) and similar proteins; Region: RING-H2_RNF24; cd16675" /db_xref="CDD:438337" polyA_site 1642 /gene="RNF24" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN
ggcagagcggcggccgggctcggggcgaggcgcctacccatgagctcagatttccagcattacagtttcaggatgccgaacatcgggttccagaacctgcctctcaacatatatatcgtggtttttggcacggccatcttcgtcttcatcctcagtttactgttctgttgctacttgatcaggcttagacatcaagcacacaaagagctttacgcctacaaacaggtaatactcaaggagaaggtgaaggagttgaacctacatgagatctgcgccgtttgcttggaggagttcaagcccaaggacgagttggggatctgcccatgcaaacatgccttccacagaaagtgcctcatcaaatggctggaggtgcgcaaggtgtgcccgctctgcaacatgccggtgctgcagctggcacagctgcacagcaagcaggaccccggccccccccagggccccctccccggagcagagaacattgtatagctctgtgccaccacggactgccccggggctgctggggggtacccggagacgaccaaagcactacggcaccagcaaggagccaagctggggacaggaggatggagagctgagagcactttagggaaggagcatccccatgccccaaaagggtgcttggccttggaatggggttttcctcgctgggaacgtggagctcagtgactgttgggaagcctcagcatgatgccttgggatggagcggccgagcggtgcctgaatgcactcaactccctctgagcatcacccaggagagccggtgtccgccccgcgcggtgctgtggggtcagtgccatccaaggggggaattttcacccctggttgcgatctctactgaggattgcagtttcttctcccaaagggctgcccagggcttggagctgggtgctttttggggtggctccccccccaccctgctcggtgccatgggctacctcagggcttccttcatccctgccatgggtaagagcatctcccatcggtgcaaccacctcagtatcacagcatggtgggggcaaaccctaccctttgggttcacgttgagcctggccctttgggtatccaagcacggatggctcagcaccacccaaagtccccacccaaccctccctgagtgccaaagctgctgtgggctgcaccaccccttcctctcccttcatcccatggggcaaattcagcccctttccaggcatcattcccccctcaaccacgcagttctttatgggagggggttccagtgttaccccacagcggggctgggtgggctctgagggggtccctcctgtacataccccacaactcccaagactgtttatggagcgtggagcctcatagacatgtttgtacactacaaattctgcagcagaatatttttttaaaaacgtttgctgttttcctttttttttggggggggggagggagtattttttttgttgttttggggcttttttttttgtaagctctatttttgtatatttaattgctatttcaagattctaatgcgtctttttttgctaatcacactattcttaaggaaaaaaaaaaaaaaagcaaagcaaaggaggagagaagtggtttgcatgtgatttgacttgaaatgtaaataaaggcaggttttgga
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]