GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-05 14:28:34, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       NM_204990                892 bp    mRNA    linear   VRT 23-SEP-2023
DEFINITION  Gallus gallus Mix paired-like homeobox (MIXL1), mRNA.
ACCESSION   NM_204990
VERSION     NM_204990.2
KEYWORDS    RefSeq.
SOURCE      Gallus gallus (chicken)
  ORGANISM  Gallus gallus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
            Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
            Phasianidae; Phasianinae; Gallus.
REFERENCE   1  (bases 1 to 892)
  AUTHORS   Tang H, Finn RD and Thomas PD.
  TITLE     TreeGrafter: phylogenetic tree-based annotation of proteins with
            Gene Ontology terms and other annotations
  JOURNAL   Bioinformatics 35 (3), 518-520 (2019)
   PUBMED   30032202
REFERENCE   2  (bases 1 to 892)
  AUTHORS   Peale FV Jr, Sugden L and Bothwell M.
  TITLE     Characterization of CMIX, a chicken homeobox gene related to the
            Xenopus gene mix.1
  JOURNAL   Mech Dev 75 (1-2), 167-170 (1998)
   PUBMED   9739137
REFERENCE   3  (bases 1 to 892)
  AUTHORS   Stein S, Roeser T and Kessel M.
  TITLE     CMIX, a paired-type homeobox gene expressed before and during
            formation of the avian primitive streak
  JOURNAL   Mech Dev 75 (1-2), 163-165 (1998)
   PUBMED   9739135
REFERENCE   4  (bases 1 to 892)
  AUTHORS   Peale FV Jr, Mason K, Hunter AW and Bothwell M.
  TITLE     Multiplex display polymerase chain reaction amplifies and resolves
            related sequences sharing a single moderately conserved domain
  JOURNAL   Anal Biochem 256 (2), 158-168 (1998)
   PUBMED   9473273
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from
            JAENSK010000062.1.
            
            On Sep 23, 2021 this sequence version replaced NM_204990.1.
            
            ##Evidence-Data-START##
            Transcript exon combination :: U34615.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA103992290, SAMEA103992415
                                           [ECO:0000348]
            ##Evidence-Data-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-322               JAENSK010000062.1  4873588-4873909     c
            323-892             JAENSK010000062.1  4872944-4873513     c
FEATURES             Location/Qualifiers
     source          1..892
                     /organism="Gallus gallus"
                     /mol_type="mRNA"
                     /db_xref="taxon:9031"
                     /chromosome="3"
                     /map="3"
     gene            1..892
                     /gene="MIXL1"
                     /gene_synonym="CMIX"
                     /note="Mix paired-like homeobox"
                     /db_xref="CGNC:66215"
                     /db_xref="GeneID:395838"
     exon            1..322
                     /gene="MIXL1"
                     /gene_synonym="CMIX"
                     /inference="alignment:Splign:2.1.0"
     CDS             14..646
                     /gene="MIXL1"
                     /gene_synonym="CMIX"
                     /note="homeodomain protein MIX; mix.1 homeobox-like
                     protein; MIX1 homeobox-like protein 1; CMIX homeobox; Mix1
                     homeobox-like 1"
                     /codon_start=1
                     /product="homeobox protein MIXL1"
                     /protein_id="NP_990321.2"
                     /db_xref="CGNC:66215"
                     /db_xref="GeneID:395838"
                     /translation="
MAALRFGPPPAELPAVPPSCPPGRWLCGTAGGSGGGPGAAPAPLAALPPAAEGAPSAQRRKRTSFTAAQLETLELVFQDTMYPDIYLRERLADATQIPESRIQVWFQNRRAKSRRQRGPPRPGAPAPPPPPPQRSPCGAAPLLRAREEHREWPPRAAGPPGSALRPHGGSGGAPAGPYPPRPAFPLPAGGGFSELGTEWEENAIGAFRAL"
     misc_feature    14..202
                     /gene="MIXL1"
                     /gene_synonym="CMIX"
                     /note="propagated from UniProtKB/Swiss-Prot (O73592.2);
                     Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
     misc_feature    order(188..202,206..208,257..259,275..277,314..316,
                     320..325,332..337,341..349,353..358)
                     /gene="MIXL1"
                     /gene_synonym="CMIX"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238039"
     misc_feature    194..355
                     /gene="MIXL1"
                     /gene_synonym="CMIX"
                     /note="Homeobox domain; Region: Homeobox; pfam00046"
                     /db_xref="CDD:425441"
     misc_feature    order(194..196,203..205,323..325,332..337,344..346)
                     /gene="MIXL1"
                     /gene_synonym="CMIX"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:238039"
     misc_feature    326..595
                     /gene="MIXL1"
                     /gene_synonym="CMIX"
                     /note="propagated from UniProtKB/Swiss-Prot (O73592.2);
                     Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
     exon            323..892
                     /gene="MIXL1"
                     /gene_synonym="CMIX"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
ctggcccgccgccatggccgcgctacgcttcgggccgcccccggcggagctgcccgcggtaccgccctcctgcccgccgggccggtggctgtgcgggacggccgggggcagcgggggagggcccggcgcggccccggcgcccctcgcggcgctgcccccggcggcggagggggctccgtcggcgcaacgtcggaaacggacgagcttcacggcggcgcagctggagacgctggagctggtgttccaggacaccatgtaccccgacatctacctgcgggagcggctggccgacgccacgcagatccccgagtcccgcatccaggtctggttccagaaccgccgcgccaagtctcgccggcagcggggaccgccccggccgggtgcccccgcaccgccaccgcccccgccccagcgctcgccgtgcggcgcggccccgctgctccgcgcccgggaggagcaccgcgagtggccgccccgcgccgccggcccgcccggctccgcgctgcgcccgcacggggggagcggaggcgccccggccgggccctacccgccccgccccgcgttccccctcccggccggcggcggcttctcggagctgggaacggagtgggaggagaacgccatcggcgccttccgagccctctgacggccggccggccctgcccgcgcctctttgcactttatcccgtggactgcgcctatttatgcacgggagatgggggcggctgcgccggttgccggcaccgtgttacactgtttacagcttctatttaacctttttaagcccccaagccgaccgaatgcactgttctagggggggtgggggtcgggaggggtccgttgttactttttgagacagaaaaataaataaaagttcccaattctgctctgc
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]